Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
- pan locus tag?: SAUPAN004793000
- symbol: SAUSA300_1807
- pan gene symbol?: glnQ
- synonym:
- product: amino acid ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
- symbol: SAUSA300_1807
- product: amino acid ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1989653..1990381
- length: 729
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914855 NCBI
- RefSeq: YP_494490 NCBI
- BioCyc: see SAUSA300_RS09890
- MicrobesOnline: 1293322 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGCCAGTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAA
GATATCAATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGT
GGTAAAAGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCTACTAAAGGTCAAGTG
ATTTTTGAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAA
ATGGGTATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATT
ATTTTAGCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTG
TCGTTATTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCA
GGTGGTCAAAAACAAAGGGTAGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATT
TTATTCGATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTA
ATGAAAGACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTT
GCCAAAGATGTAAGTGACAAAGTCATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGC
ACACCAGTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGA
GTATTATAA60
120
180
240
300
360
420
480
540
600
660
720
729
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
- symbol: SAUSA300_1807
- description: amino acid ABC transporter ATP-binding protein
- length: 242
- theoretical pI: 5.70084
- theoretical MW: 26768
- GRAVY: -0.120248
⊟Function[edit | edit source]
- TIGRFAM: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)and 79 moreD-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 232.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 226.2)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 220.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 197.3)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 195.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 194.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 185.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 145.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 143.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 137.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 133.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 125.1)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 123.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 119)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 115)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 111.5)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 108.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 106.8)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 106.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98.1)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 94.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 92)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)rad50 (TIGR00606; HMM-score: 17)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13.1)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.7)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.7)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)
- TheSEED :
- Arginine ABC transporter, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 141)and 34 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 48.7)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 44.4)ABC_ATPase; P-loop domain (PF09818; HMM-score: 27.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.2)AAA_23; AAA domain (PF13476; HMM-score: 22.8)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 20.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.4)AAA_22; AAA domain (PF13401; HMM-score: 18.9)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.5)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 15.8)AAA_18; AAA domain (PF13238; HMM-score: 15.5)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.8)AAA_25; AAA domain (PF13481; HMM-score: 14.7)AAA_30; AAA domain (PF13604; HMM-score: 14.6)AAA_33; AAA domain (PF13671; HMM-score: 14.6)AAA_13; AAA domain (PF13166; HMM-score: 14.5)ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.4)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 14.3)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 14)NADP_Rossmann (CL0063) Methyltransf_17; S-adenosyl-L-methionine methyltransferase (PF12692; HMM-score: 13.9)P-loop_NTPase (CL0023) NACHT; NACHT domain (PF05729; HMM-score: 13.6)AAA_28; AAA domain (PF13521; HMM-score: 13.6)AAA_24; AAA domain (PF13479; HMM-score: 13.5)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.4)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.8)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)AAA_14; AAA domain (PF13173; HMM-score: 12.4)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.2)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 12.1)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11.7)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1011
- Cytoplasmic Membrane Score: 0.7884
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1104
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002863
- TAT(Tat/SPI): 0.000169
- LIPO(Sec/SPII): 0.000221
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SAUSA300_1644 (pyk) pyruvate kinase [1] (data from MRSA252) SAUSA300_2189 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_1149 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_0533 (tuf) elongation factor Tu [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: ArgR/AhrC (repression) regulon, CodY (repression) regulon
ArgR/AhrC (TF) important in Arginine biosynthesis, Arginine degradation; RegPrecise transcription unit transferred from N315 data RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)