Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001905 [new locus tag: EGJ38_RS09510 ]
- pan locus tag?: SAUPAN004861000
- symbol: EGJ38_001905
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001905
- product: SE1561 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001905 [new locus tag: EGJ38_RS09510 ]
- symbol: EGJ38_001905
- product: SE1561 family protein
- replicon: chromosome
- strand: -
- coordinates: 1922166..1922327
- length: 162
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423814 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAATGAACAGCAAACAATCGAACAGATAAAAGCACGTTTAAATAAGTTTATTGAGGAT
ATCGATCATGTAAATCCTGATGAAGTACGTGTTGAAGATATAGATGAATGGATTGGATTG
TTAGATCAGCTTGAAGAAAAGGTTAAATTAGTATCTAAGTAA60
120
162
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001905 [new locus tag: EGJ38_RS09510 ]
- symbol: EGJ38_001905
- description: SE1561 family protein
- length: 53
- theoretical pI: 4.16778
- theoretical MW: 6305.07
- GRAVY: -0.681132
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.8)Energy metabolism Other tetrahydromethanopterin S-methyltransferase, subunit G (TIGR01149; EC 2.1.1.86; HMM-score: 11.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Spectrin (CL0743) Spectrin_Anc-1_2; Nuclear anchorage protein 1, spectrin repeat (PF24615; HMM-score: 16.5)and 2 moreno clan defined SERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 12.9)MtrG; Tetrahydromethanopterin S-methyltransferase, subunit G (PF04210; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8348
- Cytoplasmic Membrane Score: 0.0082
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.156
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005243
- TAT(Tat/SPI): 0.00063
- LIPO(Sec/SPII): 0.00055
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423814 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]