From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS054 [new locus tag: SA_RS09715 ]
  • pan locus tag?: SAUPAN004861000
  • symbol: SAS054
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAS054 [new locus tag: SA_RS09715 ]
  • symbol: SAS054
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1940366..1940527
  • length: 162
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAATGAACAGCAAACAATCGAACAGATAAAAGCACGTTTAAATAAGTTTATTGAGGAT
    ATCGATCATGTAAATCCTGATGAAGTACGTGTTGAAGATATAGATGAATGGATTGGATTG
    TTAGATCAGCTTGAAGAAAAGGTTAAATTAGTATCTAAGTAA
    60
    120
    162


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAS054 [new locus tag: SA_RS09715 ]
  • symbol: SAS054
  • description: hypothetical protein
  • length: 53
  • theoretical pI: 4.16778
  • theoretical MW: 6305.07
  • GRAVY: -0.681132

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.8)
    Metabolism Energy metabolism Other tetrahydromethanopterin S-methyltransferase, subunit G (TIGR01149; EC 2.1.1.86; HMM-score: 11.6)
  • TheSEED  :
    • Uncharacterized protein YfjT
    CBSS-176280.1.peg.1561  Hypothetical protein FIG009695
  • PFAM:
    Spectrin (CL0743) Spectrin_Anc-1_2; Nuclear anchorage protein 1, spectrin repeat (PF24615; HMM-score: 16.5)
    and 2 more
    no clan defined SERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 12.9)
    MtrG; Tetrahydromethanopterin S-methyltransferase, subunit G (PF04210; HMM-score: 11.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8348
    • Cytoplasmic Membrane Score: 0.0082
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.156
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005243
    • TAT(Tat/SPI): 0.00063
    • LIPO(Sec/SPII): 0.00055
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]