Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002059 [new locus tag: EGJ38_RS10280 ]
- pan locus tag?: SAUPAN005387000
- symbol: fabZ
- pan gene symbol?: fabZ
- synonym:
- alternate name: JSNZ_002059
- product: 3-hydroxyacyl-ACP dehydratase FabZ
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002059 [new locus tag: EGJ38_RS10280 ]
- symbol: fabZ
- product: 3-hydroxyacyl-ACP dehydratase FabZ
- replicon: chromosome
- strand: -
- coordinates: 2074029..2074469
- length: 441
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423960 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGAAACAATTTTTGATTATAACCAAATTAAACAAATTATACCTCACAGACAGCCATTT
TTATTAATTGATAAAGTAGTTGAATATGAAGAAGGTCAACGTTGTGTGGCTATTAAACAA
GTATCAGGAAACGAACCATTCTTTCAAGGGCATTTTCCTGAGTATGCGGTAATGCCAGGC
GTATTAATTACTGAAGCGTTAGCTCAAACAGGTGCGGTAGCTATTTTAAATAGTGAAGAA
AATAAAGGTAAAATCGCTTTATTTGCTGGTATTGATAAATGTCGTTTTAAACGTCAAGTA
GTACCTGGTGATACTTTAACGTTGGAAGTAGAAATCACTAAAATTAAAGGACCAATCGGT
AAAGGTAATGCTAAAGCTACTGTCGATGGTCAACTTGCTTGTAGTTGTGAACTTACATTT
GCAATTCAAGATGTAAAATAA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002059 [new locus tag: EGJ38_RS10280 ]
- symbol: FabZ
- description: 3-hydroxyacyl-ACP dehydratase FabZ
- length: 146
- theoretical pI: 5.78053
- theoretical MW: 16081.5
- GRAVY: -0.0369863
⊟Function[edit | edit source]
- reaction: EC 4.2.1.59? ExPASy3-hydroxyacyl-[acyl-carrier-protein] dehydratase A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H2O
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ (TIGR01750; EC 4.2.1.-; HMM-score: 176.9)and 1 moreFatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA (TIGR01749; EC 4.2.1.59; HMM-score: 24.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HotDog (CL0050) FabA; FabA-like domain (PF07977; HMM-score: 114.3)and 6 moreMaoC_dehydratas; MaoC like domain (PF01575; HMM-score: 22.3)4HBT; Thioesterase superfamily (PF03061; HMM-score: 21.6)FAS1_DH_region; FAS1-like, dehydratase domain region (PF13452; HMM-score: 13.2)C2H2-zf (CL0361) zf-C2H2_STOP2_C; STOP2-like, C2H2-type zinc finger (PF23118; HMM-score: 13)HotDog (CL0050) ApeI-like; ApeI dehydratase (PF22818; HMM-score: 12.8)4HBT_2; Thioesterase-like superfamily (PF13279; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9778
- Cytoplasmic Membrane Score: 0.0118
- Cell wall & surface Score: 0
- Extracellular Score: 0.0104
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002824
- TAT(Tat/SPI): 0.000158
- LIPO(Sec/SPII): 0.000279
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423960 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPGVLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIGKGNAKATVDGQLACSCELTFAIQDVK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)