Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002069 [new locus tag: EGJ38_RS10330 ]
- pan locus tag?: SAUPAN005399000
- symbol: atpE
- pan gene symbol?: atpE
- synonym:
- alternate name: JSNZ_002069
- product: F0F1 ATP synthase subunit C
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002069 [new locus tag: EGJ38_RS10330 ]
- symbol: atpE
- product: F0F1 ATP synthase subunit C
- replicon: chromosome
- strand: -
- coordinates: 2082217..2082429
- length: 213
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423970 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATTTAATCGCAGCAGCAATCGCAATTGGTTTATCAGCATTAGGAGCAGGTATCGGT
AACGGTTTAATCGTTTCAAGAACAGTTGAAGGTGTAGCACGTCAACCAGAAGCACGTGGT
CAATTAATGGGTATCATGTTCATTGGTGTAGGTTTAGTTGAGGCATTACCTATCATCGGT
GTAGTAATTGCATTCATGACATTTGCTGGATAA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002069 [new locus tag: EGJ38_RS10330 ]
- symbol: AtpE
- description: F0F1 ATP synthase subunit C
- length: 70
- theoretical pI: 6.61182
- theoretical MW: 6979.38
- GRAVY: 1.25429
⊟Function[edit | edit source]
- reaction: EC 7.1.2.2? ExPASynon-specified enzyme name
- TIGRFAM: Energy metabolism ATP-proton motive force interconversion ATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 73.7)and 1 morealternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 31.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 64.4)and 1 moreDUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9584
- Cell wall & surface Score: 0
- Extracellular Score: 0.0414
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.064922
- TAT(Tat/SPI): 0.003265
- LIPO(Sec/SPII): 0.180633
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423970 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIGVVIAFMTFAG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)