From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • pan locus tag?: SAUPAN005399000
  • symbol: atpE
  • pan gene symbol?: atpE
  • synonym:
  • product: F0F1 ATP synthase subunit C

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • symbol: atpE
  • product: F0F1 ATP synthase subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 2230641..2230853
  • length: 213
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATTTAATCGCAGCAGCAATCGCAATTGGTTTATCAGCATTAGGAGCAGGTATCGGT
    AACGGTTTAATCGTTTCAAGAACAGTTGAAGGTGTAGCACGTCAACCAGAAGCACGTGGT
    CAATTAATGGGTATCATGTTCATTGGTGTAGGTTTAGTTGAGGCATTACCTATCATCGGT
    GTAGTAATTGCATTCATGACATTTGCTGGATAA
    60
    120
    180
    213

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • symbol: AtpE
  • description: F0F1 ATP synthase subunit C
  • length: 70
  • theoretical pI: 6.61182
  • theoretical MW: 6979.38
  • GRAVY: 1.25429

⊟Function[edit | edit source]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 73.7)
    and 1 more
    alternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 31.8)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 55.1)
    and 1 more
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 16.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.064922
    • TAT(Tat/SPI): 0.003265
    • LIPO(Sec/SPII): 0.180633
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIGVVIAFMTFAG

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_2012&oldid=70567"