From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002161 [new locus tag: EGJ38_RS10785 ]
  • pan locus tag?: SAUPAN005587000
  • symbol: lacF
  • pan gene symbol?: lacF
  • synonym:
  • alternate name: JSNZ_002161
  • product: PTS lactose/cellobiose transporter subunit IIA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002161 [new locus tag: EGJ38_RS10785 ]
  • symbol: lacF
  • product: PTS lactose/cellobiose transporter subunit IIA
  • replicon: chromosome
  • strand: -
  • coordinates: 2180593..2180904
  • length: 312
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424051 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATAGAGAAGAAGTCCAATTATTAGGTTTTGAAATTGTTGCATTTGCAGGGGATGCA
    CGTTCTAAGTTTTTAGAAGCATTGACAGCAGCTCAAGCTGGAGATTTTGCAAAAGCAGAT
    GCATTGATTGAAGAAGGAAACAATTGCATTGCTGAAGCGCATAGAGCACAAACAAGCCTG
    TTAGCTAAAGAAGCGCAAGGTGATGATATTGCATACAGTGTAACGATGATGCATGGTCAA
    GACCATTTAATGACAACAATTTTACTGAAAGATTTAATGAAGCATTTATTAGAATTTTAT
    AAAAGAGGGTGA
    60
    120
    180
    240
    300
    312

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002161 [new locus tag: EGJ38_RS10785 ]
  • symbol: LacF
  • description: PTS lactose/cellobiose transporter subunit IIA
  • length: 103
  • theoretical pI: 4.85685
  • theoretical MW: 11369.9
  • GRAVY: -0.0990291

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose-specific IIa component (TIGR00823; EC 2.7.1.69; HMM-score: 157.8)
    and 1 more
    antimicrobial peptide, SdpC family (TIGR04032; HMM-score: 13.1)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined PTS_IIA; PTS system, Lactose/Cellobiose specific IIA subunit (PF02255; HMM-score: 112.5)
    and 1 more
    DUF1771; Domain of unknown function (DUF1771) (PF08590; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9957
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0036
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.047697
    • TAT(Tat/SPI): 0.120458
    • LIPO(Sec/SPII): 0.004871
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424051 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSLLAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: LacR (repression) regulon
    LacR(TF)important in Lactose utilization;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]