From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
  • pan locus tag?: SAUPAN005680000
  • symbol: infA
  • pan gene symbol?: infA
  • synonym:
  • product: translation initiation factor IF-1

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
  • symbol: infA
  • product: translation initiation factor IF-1
  • replicon: chromosome
  • strand: -
  • coordinates: 2204496..2204714
  • length: 219
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424081 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCTAAACAAGATGTAATTGAATTAGAAGGTACTGTATTAGATACTTTACCGAACGCA
    ATGTTTAAAGTAGAATTAGAAAATGGTCATGAGATTTTAGCTCACGTAAGTGGTAAAATC
    AGAATGAATTACATTCGTATTCTACCTGGCGACAAAGTAACTGTTGAGATGTCTCCGTAC
    GATTTAACACGCGGAAGAATTACTTATCGTTATAAATAA
    60
    120
    180
    219

Protein[edit | edit source]

Protein Data Bank: 2N8N

General[edit | edit source]

  • locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
  • symbol: InfA
  • description: translation initiation factor IF-1
  • length: 72
  • theoretical pI: 7.67987
  • theoretical MW: 8279.59
  • GRAVY: -0.276389

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 132.5)
    and 1 more
    Genetic information processing Protein synthesis Translation factors translation initiation factor eIF-1A (TIGR00523; HMM-score: 22)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    OB (CL0021) eIF-1a; Translation initiation factor 1A / IF-1 (PF01176; HMM-score: 100.1)
    and 3 more
    RsgA_N; RsgA N-terminal domain (PF16745; HMM-score: 14.4)
    TOBE_2; TOBE domain (PF08402; HMM-score: 14)
    E-set (CL0159) Ig_mannosidase; Ig-fold domain (PF17753; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9842
    • Cytoplasmic Membrane Score: 0.0024
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0132
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003057
    • TAT(Tat/SPI): 0.000252
    • LIPO(Sec/SPII): 0.000283
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424081 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]