Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
- pan locus tag?: SAUPAN005680000
- symbol: infA
- pan gene symbol?: infA
- synonym:
- product: translation initiation factor IF-1
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
- symbol: infA
- product: translation initiation factor IF-1
- replicon: chromosome
- strand: -
- coordinates: 2204496..2204714
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424081 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAAACAAGATGTAATTGAATTAGAAGGTACTGTATTAGATACTTTACCGAACGCA
ATGTTTAAAGTAGAATTAGAAAATGGTCATGAGATTTTAGCTCACGTAAGTGGTAAAATC
AGAATGAATTACATTCGTATTCTACCTGGCGACAAAGTAACTGTTGAGATGTCTCCGTAC
GATTTAACACGCGGAAGAATTACTTATCGTTATAAATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002192 [new locus tag: EGJ38_RS10940 ]
- symbol: InfA
- description: translation initiation factor IF-1
- length: 72
- theoretical pI: 7.67987
- theoretical MW: 8279.59
- GRAVY: -0.276389
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 132.5)and 1 moreProtein synthesis Translation factors translation initiation factor eIF-1A (TIGR00523; HMM-score: 22)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: OB (CL0021) eIF-1a; Translation initiation factor 1A / IF-1 (PF01176; HMM-score: 100.1)and 3 moreRsgA_N; RsgA N-terminal domain (PF16745; HMM-score: 14.4)TOBE_2; TOBE domain (PF08402; HMM-score: 14)E-set (CL0159) Ig_mannosidase; Ig-fold domain (PF17753; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9842
- Cytoplasmic Membrane Score: 0.0024
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0132
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003057
- TAT(Tat/SPI): 0.000252
- LIPO(Sec/SPII): 0.000283
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424081 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)