From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002191 [new locus tag: EGJ38_RS10935 ]
  • pan locus tag?: SAUPAN005679000
  • symbol: rpmJ
  • pan gene symbol?: rpmJ
  • synonym:
  • alternate name: JSNZ_002191
  • product: 50S ribosomal protein L36

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002191 [new locus tag: EGJ38_RS10935 ]
  • symbol: rpmJ
  • product: 50S ribosomal protein L36
  • replicon: chromosome
  • strand: -
  • coordinates: 2204351..2204464
  • length: 114
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424080 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
    GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA
    60
    114

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: EGJ38_002191 [new locus tag: EGJ38_RS10935 ]
  • symbol: RpmJ
  • description: 50S ribosomal protein L36
  • length: 37
  • theoretical pI: 11.0798
  • theoretical MW: 4305.35
  • GRAVY: -0.808108

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL36 (TIGR01022; HMM-score: 82.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Ribosomal_L36; Ribosomal protein L36 (PF00444; HMM-score: 73.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2834
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.7159
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.157083
    • TAT(Tat/SPI): 0.006832
    • LIPO(Sec/SPII): 0.047312
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424080 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]