Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2129 [new locus tag: NWMN_RS12310 ]
- pan locus tag?: SAUPAN005679000
- symbol: rpmJ
- pan gene symbol?: rpmJ
- synonym:
- product: 50S ribosomal protein L36
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2129 [new locus tag: NWMN_RS12310 ]
- symbol: rpmJ
- product: 50S ribosomal protein L36
- replicon: chromosome
- strand: -
- coordinates: 2364158..2364271
- length: 114
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332416 NCBI
- RefSeq: YP_001333163 NCBI
- BioCyc:
- MicrobesOnline: 3707731 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA60
114
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2129 [new locus tag: NWMN_RS12310 ]
- symbol: RpmJ
- description: 50S ribosomal protein L36
- length: 37
- theoretical pI: 11.0798
- theoretical MW: 4305.35
- GRAVY: -0.808108
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL36 (TIGR01022; HMM-score: 82.8)
- TheSEED :
- LSU ribosomal protein L36p
- LSU ribosomal protein L36p, zinc-dependent
- PFAM: no clan defined Ribosomal_L36; Ribosomal protein L36 (PF00444; HMM-score: 73.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2834
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.7159
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.157083
- TAT(Tat/SPI): 0.006832
- LIPO(Sec/SPII): 0.047312
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]