Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002224 [new locus tag: EGJ38_RS11100 ]
- pan locus tag?: SAUPAN005715000
- symbol: EGJ38_002224
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002224
- product: SE1832 family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002224 [new locus tag: EGJ38_RS11100 ]
- symbol: EGJ38_002224
- product: SE1832 family protein
- replicon: chromosome
- strand: +
- coordinates: 2224158..2224322
- length: 165
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424113 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTCTTTAGAAAACCAACTAGCCGAACTTAAATATGATTATGTTCGTCTTCAAGGTGAC
ATAGAAAAACGGGAATCTTTGAATTTAGATACTTCCGCACTTGTTCGTCAACTTAAAGAT
ATTGAAAATGAAATTAGAAACGTTCGTGCTCAAATGCAAGATTAA60
120
165
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002224 [new locus tag: EGJ38_RS11100 ]
- symbol: EGJ38_002224
- description: SE1832 family protein
- length: 54
- theoretical pI: 4.46473
- theoretical MW: 6394.16
- GRAVY: -0.825926
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 21.5)EAD9; Effector-associated domain 9 (PF19962; HMM-score: 20.3)and 1 moreGTP-bdg_M; GTP-binding GTPase Middle Region (PF16360; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9117
- Cytoplasmic Membrane Score: 0.0063
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0818
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006623
- TAT(Tat/SPI): 0.000892
- LIPO(Sec/SPII): 0.001715
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424113 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLENQLAELKYDYVRLQGDIEKRESLNLDTSALVRQLKDIENEIRNVRAQMQD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]