From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002274 [new locus tag: EGJ38_RS11350 ]
  • pan locus tag?: SAUPAN005784000
  • symbol: EGJ38_002274
  • pan gene symbol?: —
  • synonym:
  • alternate name: JSNZ_002274
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002274 [new locus tag: EGJ38_RS11350 ]
  • symbol: EGJ38_002274
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2270582..2270815
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424161 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTAAAAACGTCAGCTGTAATTTCTAATACATTATTAGTCATAGGTTTAGTCTGTCTA
    TTTATGATGAAATTAGTGTTAGCTATTACTTTTTTTGCTGTTTCATTATCAATTAGTCTA
    GTTGTCTTTAATATGATGTTCAGAGATAGAACAACGATGAAAGTAATCGTTAACGCTTCT
    TTTTTAATCGTAATATTAGCGATTGTAGTGGCATATTTTTTATTGTCTAAGTAA
    60
    120
    180
    234


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_002274 [new locus tag: EGJ38_RS11350 ]
  • symbol: EGJ38_002274
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 10.8508
  • theoretical MW: 8548.69
  • GRAVY: 1.6974

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, NCTC8325
  • PFAM:
    no clan defined TMEM169; TMEM169 protein family (PF15052; HMM-score: 10.1)
    and 2 more
    Chemosens_recp (CL0176) 7tm_6; 7tm Odorant receptor (PF02949; HMM-score: 7.9)
    no clan defined DUF6724; Family of unknown function (DUF6724) (PF20485; HMM-score: 7.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9809
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0189
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007246
    • TAT(Tat/SPI): 0.002057
    • LIPO(Sec/SPII): 0.017757
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424161 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLKTSAVISNTLLVIGLVCLFMMKLVLAITFFAVSLSISLVVFNMMFRDRTTMKVIVNASFLIVILAIVVAYFLLSK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=EGJ38_002274&oldid=116200"