Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002451 [new locus tag: EGJ38_RS12235 ]
- pan locus tag?: SAUPAN006039000
- symbol: EGJ38_002451
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002451
- product: DUF1433 domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002451 [new locus tag: EGJ38_RS12235 ]
- symbol: EGJ38_002451
- product: DUF1433 domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 2452851..2453270
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424332 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCCAAAAAACATGTTTTTATAAATATTGGTGTCATATTGTGTATATGTATAGTTTCT
ACGGTCATGCATTTTAAAATGAAATATGATGAAAAAGAAAAACAAAAAGCGATTTACTAC
AAAGAACAACAAGCGCGCATTACACTTTATCTCAAGCATAACACTAAAGAACCGAATACA
ATCAAATCTGTACATTTCACAAACTTGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
GGTTACATAAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
TATCAATTTGGTGGTGCTATGATAGAAAGTGAAAAATTAAGCGAGTTACTAAAGCCAGCC
AATCAGTTAAAATCACCAGATGATATAAAAAAAGAACTAAATAAAAAGAAGAGTCACTAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002451 [new locus tag: EGJ38_RS12235 ]
- symbol: EGJ38_002451
- description: DUF1433 domain-containing protein
- length: 139
- theoretical pI: 9.64928
- theoretical MW: 16052.5
- GRAVY: -0.658273
⊟Function[edit | edit source]
- TIGRFAM: Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 12.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 11)
- TheSEED: data available for N315
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 129.5)and 3 moreOB (CL0021) RNA_pol_Rbc25; RNA polymerase III subunit Rpc25 (PF08292; HMM-score: 14.7)no clan defined DUF7299; Family of unknown function (DUF7299) (PF23973; HMM-score: 14.3)PMP1_2; ATPase proteolipid family (PF08114; HMM-score: 9.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.7171
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.2823
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.20758
- TAT(Tat/SPI): 0.001564
- LIPO(Sec/SPII): 0.086401
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424332 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKKHVFINIGVILCICIVSTVMHFKMKYDEKEKQKAIYYKEQQARITLYLKHNTKEPNTIKSVHFTNLETSPMGSAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESEKLSELLKPANQLKSPDDIKKELNKKKSH
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002450 < EGJ38_002451 < EGJ38_002452
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)