Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2263 [new locus tag: SA_RS12990 ]
- pan locus tag?: SAUPAN006039000
- symbol: SA2263
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2263 [new locus tag: SA_RS12990 ]
- symbol: SA2263
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2541275..2541694
- length: 420
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1125191 NCBI
- RefSeq: NP_375587 NCBI
- BioCyc: see SA_RS12990
- MicrobesOnline: 104613 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAACAAAAAACATGTTTTTGTAATTATTGGTGTCATTTTATGTATATGTATAGTTGCA
TCAGTCATTTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
AAAGAACAACAGGAGCGTATTACACTCTATCTCCAGCATAATACCAAAGAACCCAATACC
ATCAAATCTGTGCATTTCACAAGTTTAAAAAGAGGACCCATGGGCGATGCCGTAATTGAA
GGCTACATCAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
TATCAGTTTGGTGGTGCTATGATAGAAAGTGAAAGATTAAGTGAGTTACTAAAACCAGCG
CATCAATTAAAATCACCTGACGAAATCAAAGAAGAATTAGACAAAAAAGAAGGCCACTAG60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2263 [new locus tag: SA_RS12990 ]
- symbol: SA2263
- description: hypothetical protein
- length: 139
- theoretical pI: 8.21029
- theoretical MW: 16097.4
- GRAVY: -0.604317
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 15.2)Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 14.3)Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 13.1)
- TheSEED :
- FIG01108221: hypothetical protein
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 129.5)and 10 moreViral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 15.9)DUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 15.5)DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 14.1)DUF7299; Family of unknown function (DUF7299) (PF23973; HMM-score: 13.5)Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 13.3)PspB; Phage shock protein B (PF06667; HMM-score: 11.8)DUF4500; Domain of unknown function (DUF4500) (PF14937; HMM-score: 11.7)ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 11.5)no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 10.6)PMP1_2; ATPase proteolipid family (PF08114; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.771
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.2282
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.218204
- TAT(Tat/SPI): 0.00235
- LIPO(Sec/SPII): 0.094313
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKKHVFVIIGVILCICIVASVIYLKVKYDEKEKQKAIYYKEQQERITLYLQHNTKEPNTIKSVHFTSLKRGPMGDAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESERLSELLKPAHQLKSPDEIKEELDKKEGH
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.