From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • pan locus tag?: SAUPAN006039000
  • symbol: SA_RS12990
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • symbol: SA_RS12990
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2541275..2541694
  • length: 420
  • essential: no DEG

Accession numbers[edit | edit source]

  • Location: NC_002745 (2541275..2541694) NCBI
  • BioCyc: SA_RS12990 BioCyc
  • MicrobesOnline: see SA2263

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAACAAAAAACATGTTTTTGTAATTATTGGTGTCATTTTATGTATATGTATAGTTGCA
    TCAGTCATTTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
    AAAGAACAACAGGAGCGTATTACACTCTATCTCCAGCATAATACCAAAGAACCCAATACC
    ATCAAATCTGTGCATTTCACAAGTTTAAAAAGAGGACCCATGGGCGATGCCGTAATTGAA
    GGCTACATCAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
    TATCAGTTTGGTGGTGCTATGATAGAAAGTGAAAGATTAAGTGAGTTACTAAAACCAGCG
    CATCAATTAAAATCACCTGACGAAATCAAAGAAGAATTAGACAAAAAAGAAGGCCACTAG
    60
    120
    180
    240
    300
    360
    420


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • symbol: SA_RS12990
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 8.21029
  • theoretical MW: 16097.4
  • GRAVY: -0.604317

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 15.2)
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 14.3)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 13.1)
  • TheSEED: see SA2263
  • PFAM:
    no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 129.5)
    and 10 more
    Viral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 15.9)
    DUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 15.5)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 14.1)
    DUF7299; Family of unknown function (DUF7299) (PF23973; HMM-score: 13.5)
    Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 13.3)
    PspB; Phage shock protein B (PF06667; HMM-score: 11.8)
    DUF4500; Domain of unknown function (DUF4500) (PF14937; HMM-score: 11.7)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 11.5)
    no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 10.6)
    PMP1_2; ATPase proteolipid family (PF08114; HMM-score: 7.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.771
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.2282
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.218204
    • TAT(Tat/SPI): 0.00235
    • LIPO(Sec/SPII): 0.094313
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNKKHVFVIIGVILCICIVASVIYLKVKYDEKEKQKAIYYKEQQERITLYLQHNTKEPNTIKSVHFTSLKRGPMGDAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESERLSELLKPAHQLKSPDEIKEELDKKEGH

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]