From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002497 [new locus tag: EGJ38_RS12465 ]
  • pan locus tag?: SAUPAN006164000
  • symbol: mhqR
  • pan gene symbol?: mhqR
  • synonym:
  • alternate name: JSNZ_002497
  • product: MarR family winged helix-turn-helix transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002497 [new locus tag: EGJ38_RS12465 ]
  • symbol: mhqR
  • product: MarR family winged helix-turn-helix transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2505574..2506008
  • length: 435
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424376 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGATCGAACGAAACAATCTCTCAATGTTTTTGTCGGAATGAATAGGGCGTTAGACACA
    TTAGAGCAAATTACAAAAGAAGACGTAAAGCGATATGGCTTAAATATTACTGAATTTGCA
    GTGCTCGAGTTGCTTTATAATAAAGGTCCGCAACCAATTCAACGTATTAGAGACCGCGTA
    TTAATTGCAAGTAGCAGCATTTCATATGTTGTAAGTCAATTAGAGGACAAAGGTTGGATT
    ACACGTGAAAAGGATAAAGATGATAAACGTGTATATATGGCTTGTTTAACTGAAAAAGGT
    CAAAGTCAAATGGTAGATATTTTCCCTAAGCATGCTGAGACATTAACAAAAGCGTTTGAT
    GTGTTAACAAAGGATGAATTAACAATCTTACAACAAGCGTTTAAGAAACTAAGTGCACAA
    TCTACAGAAGTGTAA
    60
    120
    180
    240
    300
    360
    420
    435


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002497 [new locus tag: EGJ38_RS12465 ]
  • symbol: MhqR
  • description: MarR family winged helix-turn-helix transcriptional regulator
  • length: 144
  • theoretical pI: 8.4336
  • theoretical MW: 16543.9
  • GRAVY: -0.429861

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 39.5)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 34.6)
    and 6 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 28)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 21.9)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 20.5)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 13.9)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 13.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 62.3)
    and 16 more
    MarR_2; MarR family (PF12802; HMM-score: 45.8)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 45.5)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 42)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 30.9)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 29.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 26.6)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 25.8)
    F-93_WHD; F-93, winged-helix domain (PF22194; HMM-score: 17.3)
    DUF7343; Domain of unknown function (DUF7343) (PF24034; HMM-score: 16.9)
    DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 16.5)
    HTH_56; Cch helix turn helix domain (PF18662; HMM-score: 16.1)
    PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15.2)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 14.8)
    DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 14.1)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 13.1)
    MCM_C; MCM protein C-terminal winged helix-turn-helix domain (PF21100; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9657
    • Cytoplasmic Membrane Score: 0.0299
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0043
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007254
    • TAT(Tat/SPI): 0.000697
    • LIPO(Sec/SPII): 0.000597
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424376 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRVLIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMVDIFPKHAETLTKAFDVLTKDELTILQQAFKKLSAQSTEV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]