From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2459 [new locus tag: SAUSA300_RS13640 ]
  • pan locus tag?: SAUPAN006164000
  • symbol: SAUSA300_2459
  • pan gene symbol?: mhqR
  • synonym:
  • product: MarR family transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2459 [new locus tag: SAUSA300_RS13640 ]
  • symbol: SAUSA300_2459
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2656437..2656871
  • length: 435
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGATCGAACGAAACAATCTCTCAATGTTTTTGTCGGAATGAATAGGGCGTTAGACACA
    TTAGAGCAAATTACAAAAGAAGACGTAAAGCGATATGGCTTAAATATTACTGAATTTGCA
    GTGCTCGAGTTGCTTTATAATAAAGGTCCGCAACCAATTCAACGTATTAGAGACCGCGTA
    TTAATTGCAAGTAGCAGCATTTCATATGTTGTAAGTCAATTAGAGGACAAAGGTTGGATT
    ACACGTGAAAAGGATAAAGATGATAAACGTGTATATATGGCTTGTTTAACTGAAAAAGGT
    CAAAGTCAAATGGCAGATATTTTCCCTAAGCATGCTGAGACATTAACAAAAGCGTTTGAT
    GTGTTAACAAAGGATGAATTAACAATCTTACAACAAGCGTTTAAGAAACTAAGTGCACAA
    TCTACAGAAGTGTAA
    60
    120
    180
    240
    300
    360
    420
    435

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2459 [new locus tag: SAUSA300_RS13640 ]
  • symbol: SAUSA300_2459
  • description: MarR family transcriptional regulator
  • length: 144
  • theoretical pI: 8.4336
  • theoretical MW: 16515.9
  • GRAVY: -0.446528

⊟Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.4)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 35.9)
    and 6 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 28.5)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 23.2)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 20.5)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 15)
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)
  • TheSEED  :
    • Transcriptional regulator, MarR family
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 61.8)
    and 7 more
    MarR_2; MarR family (PF12802; HMM-score: 42.9)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 38)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 30.8)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 30.4)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 28.3)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 26.6)
    PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007254
    • TAT(Tat/SPI): 0.000697
    • LIPO(Sec/SPII): 0.000597
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRVLIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFDVLTKDELTILQQAFKKLSAQSTEV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Verena Nadin Fritsch, Vu Van Loi, Tobias Busche, Anna Sommer, Karsten Tedin, Dennis J Nürnberg, Jörn Kalinowski, Jörg Bernhardt, Marcus Fulde, Haike Antelmann
    The MarR-Type Repressor MhqR Confers Quinone and Antimicrobial Resistance in Staphylococcus aureus.
    Antioxid Redox Signal: 2019, 31(16);1235-1252
    [PubMed:31310152] [WorldCat.org] [DOI] (I p)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2459&oldid=104060"