Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13640 [old locus tag: SAUSA300_2459 ]
- pan locus tag?: SAUPAN006164000
- symbol: SAUSA300_RS13640
- pan gene symbol?: mhqR
- synonym:
- product: MarR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13640 [old locus tag: SAUSA300_2459 ]
- symbol: SAUSA300_RS13640
- product: MarR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2656437..2656871
- length: 435
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2656437..2656871) NCBI
- BioCyc: SAUSA300_RS13640 BioCyc
- MicrobesOnline: see SAUSA300_2459
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGATCGAACGAAACAATCTCTCAATGTTTTTGTCGGAATGAATAGGGCGTTAGACACA
TTAGAGCAAATTACAAAAGAAGACGTAAAGCGATATGGCTTAAATATTACTGAATTTGCA
GTGCTCGAGTTGCTTTATAATAAAGGTCCGCAACCAATTCAACGTATTAGAGACCGCGTA
TTAATTGCAAGTAGCAGCATTTCATATGTTGTAAGTCAATTAGAGGACAAAGGTTGGATT
ACACGTGAAAAGGATAAAGATGATAAACGTGTATATATGGCTTGTTTAACTGAAAAAGGT
CAAAGTCAAATGGCAGATATTTTCCCTAAGCATGCTGAGACATTAACAAAAGCGTTTGAT
GTGTTAACAAAGGATGAATTAACAATCTTACAACAAGCGTTTAAGAAACTAAGTGCACAA
TCTACAGAAGTGTAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13640 [old locus tag: SAUSA300_2459 ]
- symbol: SAUSA300_RS13640
- description: MarR family transcriptional regulator
- length: 144
- theoretical pI: 8.4336
- theoretical MW: 16515.9
- GRAVY: -0.446528
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.4)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 35.9)and 6 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 28.5)EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 23.2)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 20.5)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 15)Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.4)
- TheSEED: see SAUSA300_2459
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 63.1)and 17 moreStaph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 46.8)MarR_2; MarR family (PF12802; HMM-score: 45.9)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 42.1)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 31.4)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 30.2)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 26.7)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 26.1)F-93_WHD; F-93, winged-helix domain (PF22194; HMM-score: 17.3)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 16.9)DUF7343; Domain of unknown function (DUF7343) (PF24034; HMM-score: 16.9)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 16.3)HTH_56; Cch helix turn helix domain (PF18662; HMM-score: 15.7)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 14.9)DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 14.2)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 13.1)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 12.5)MCM_C; MCM protein C-terminal winged helix-turn-helix domain (PF21100; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9771
- Cytoplasmic Membrane Score: 0.0195
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0033
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007254
- TAT(Tat/SPI): 0.000697
- LIPO(Sec/SPII): 0.000597
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446298380 NCBI
- RefSeq: WP_000376235 NCBI
- UniProt: see SAUSA300_2459
⊟Protein sequence[edit | edit source]
- MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRVLIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFDVLTKDELTILQQAFKKLSAQSTEV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]