Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002536 [new locus tag: EGJ38_RS12660 ]
- pan locus tag?: SAUPAN006219000
- symbol: cwrA
- pan gene symbol?: cwrA
- synonym:
- alternate name: JSNZ_002536
- product: cell wall inhibition responsive protein CwrA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002536 [new locus tag: EGJ38_RS12660 ]
- symbol: cwrA
- product: cell wall inhibition responsive protein CwrA
- replicon: chromosome
- strand: +
- coordinates: 2543850..2544041
- length: 192
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424415 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGAATATTAATTACAGGCACAGTTGCTATCTTAATCATTTTAGGTTTGGTCAAAACG
ATACAAGATTACGAAATGACAAACGACACGAGTCGTCAGTTGTCAGACAACAAAGATGAT
GATAAAGTCATCCATCTTAATAATTTTAAAAATTTACATGCGAAAGAATTTAACCCATCT
GATTTCTTTTAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002536 [new locus tag: EGJ38_RS12660 ]
- symbol: CwrA
- description: cell wall inhibition responsive protein CwrA
- length: 63
- theoretical pI: 5.58216
- theoretical MW: 7266.26
- GRAVY: -0.233333
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0009
- Cytoplasmic Membrane Score: 0.4968
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.5015
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 20 aa
- SP(Sec/SPI): 0.461237
- TAT(Tat/SPI): 0.000815
- LIPO(Sec/SPII): 0.122821
- Cleavage Site: CS pos: 20-21. VKT-IQ. Pr: 0.0791
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424415 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPSDFF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: VraR (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
Mol Microbiol: 2003, 49(3);807-21
[PubMed:12864861] [WorldCat.org] [DOI] (P p) - ↑ Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
Antimicrob Agents Chemother: 2013, 57(1);83-95
[PubMed:23070169] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Carl J Balibar, Xiaoyu Shen, Dorothy McGuire, Donghui Yu, David McKenney, Jianshi Tao
cwrA, a gene that specifically responds to cell wall damage in Staphylococcus aureus.
Microbiology (Reading): 2010, 156(Pt 5);1372-1383
[PubMed:20167623] [WorldCat.org] [DOI] (I p)