From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2456 [new locus tag: NWMN_RS14115 ]
  • pan locus tag?: SAUPAN006219000
  • symbol: NWMN_2456
  • pan gene symbol?: cwrA
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2456 [new locus tag: NWMN_RS14115 ]
  • symbol: NWMN_2456
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2702153..2702344
  • length: 192
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAGAATATTAATTACAGGCACAGTTGCTATCTTAATCATTCTAGGTTTGGTCAAAACG
    ATACAAGATTACGAAATGACAAACGACACGAGTCGTCAGTTGTCAGACAACAAAGATGAT
    GATAAAGTCATCCATCTTAATAATTTTAAAAATTTACATGCGAAAGAATTTAACCCATCT
    GATTTCTTTTAA
    60
    120
    180
    192


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2456 [new locus tag: NWMN_RS14115 ]
  • symbol: NWMN_2456
  • description: hypothetical protein
  • length: 63
  • theoretical pI: 5.58216
  • theoretical MW: 7266.26
  • GRAVY: -0.233333

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • hypothetical protein
    CBSS-196620.1.peg.2477  Hypothetical protein FIG016047
  • PFAM:

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0009
    • Cytoplasmic Membrane Score: 0.4968
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.5015
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 20 aa
    • SP(Sec/SPI): 0.461237
    • TAT(Tat/SPI): 0.000815
    • LIPO(Sec/SPII): 0.122821
    • Cleavage Site: CS pos: 20-21. VKT-IQ. Pr: 0.0791
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPSDFF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [1] [2]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  2. Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Carl J Balibar, Xiaoyu Shen, Dorothy McGuire, Donghui Yu, David McKenney, Jianshi Tao
cwrA, a gene that specifically responds to cell wall damage in Staphylococcus aureus.
Microbiology (Reading): 2010, 156(Pt 5);1372-1383
[PubMed:20167623] [WorldCat.org] [DOI] (I p)