Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002661 [new locus tag: EGJ38_RS13285 ]
- pan locus tag?: SAUPAN006424000
- symbol: EGJ38_002661
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002661
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002661 [new locus tag: EGJ38_RS13285 ]
- symbol: EGJ38_002661
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2681241..2681420
- length: 180
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424537 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAAAGTGAATTGAGCAACTCAGGAATAGATGTCACTGTTAAAGATGTTGAAAAGTAT
ATGAATCGATATAATGAAGTTATGAAGGGAAAAAATGGCGAAAAAGCTAAAGAGTTATGT
TTGTCGTTACTACCTATTAATATCATAGTTGTCTTTACATTCTTTGTATTTATACTATAA60
120
180
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002661 [new locus tag: EGJ38_RS13285 ]
- symbol: EGJ38_002661
- description: hypothetical protein
- length: 59
- theoretical pI: 8.48007
- theoretical MW: 6757.99
- GRAVY: 0.205085
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for USA300_FPR3757
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0089
- Cytoplasmic Membrane Score: 0.8951
- Cell wall & surface Score: 0
- Extracellular Score: 0.096
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025096
- TAT(Tat/SPI): 0.000707
- LIPO(Sec/SPII): 0.03186
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424537 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKSELSNSGIDVTVKDVEKYMNRYNEVMKGKNGEKAKELCLSLLPINIIVVFTFFVFIL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]