Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2695 [new locus tag: SACOL_RS14995 ]
- pan locus tag?: SAUPAN006424000
- symbol: SACOL2695
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2695 [new locus tag: SACOL_RS14995 ]
- symbol: SACOL2695
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2769888..2770100
- length: 213
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3238362 NCBI
- RefSeq: YP_187481 NCBI
- BioCyc: see SACOL_RS14995
- MicrobesOnline: 914161 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGGATAATCACAATACGAAATCAAAAATAATTATAAAAAGTAAATTGAGCAACTCAGGA
ATAGATGTCACTGTTAAAGATGTCGAAAAGTATATGAATCGATATAATGAAGTTATGAAG
GGAAAAAATGGCGAAAAAGCTAAAGAGTTATGTTTGTCGTTACTACCTATTAATATCATA
GTTGTCTTTACATTCTTTGTATTTATACTATAA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2695 [new locus tag: SACOL_RS14995 ]
- symbol: SACOL2695
- description: hypothetical protein
- length: 70
- theoretical pI: 9.95203
- theoretical MW: 8021.49
- GRAVY: 0.0314286
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for USA300_FPR3757
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0119
- Cytoplasmic Membrane Score: 0.5391
- Cell wall & surface Score: 0
- Extracellular Score: 0.449
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009999
- TAT(Tat/SPI): 0.000173
- LIPO(Sec/SPII): 0.007037
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDNHNTKSKIIIKSKLSNSGIDVTVKDVEKYMNRYNEVMKGKNGEKAKELCLSLLPINIIVVFTFFVFIL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]