Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS00930 [old locus tag: EGJ38_000186 ]
- pan locus tag?: SAUPAN001117000
- symbol: EGJ38_RS00930
- pan gene symbol?: —
- synonym:
- product: PTS sugar transporter subunit IIB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS00930 [old locus tag: EGJ38_000186 ]
- symbol: EGJ38_RS00930
- product: PTS sugar transporter subunit IIB
- replicon: chromosome
- strand: +
- coordinates: 225105..225383
- length: 279
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (225105..225383) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAAT
GCAATTGAGGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATT
ACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAA
AAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAA
GAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS00930 [old locus tag: EGJ38_000186 ]
- symbol: EGJ38_RS00930
- description: PTS sugar transporter subunit IIB
- length: 92
- theoretical pI: 5.86126
- theoretical MW: 10178.8
- GRAVY: -0.105435
⊟Function[edit | edit source]
- reaction: EC 2.7.1.-? ExPASy
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)Signal transduction PTS PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)and 2 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)Signal transduction PTS PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 53.4)and 4 moreno clan defined DUF5737; Family of unknown function (DUF5737) (PF19008; HMM-score: 14.5)Iso_DH (CL0270) PTA_PTB; Phosphate acetyl/butaryl transferase (PF01515; HMM-score: 13.7)NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 13.4)no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9948
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0041
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.471099
- TAT(Tat/SPI): 0.002537
- LIPO(Sec/SPII): 0.021079
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000815795 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]