From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0230 [new locus tag: SACOL_RS01170 ]
  • pan locus tag?: SAUPAN001117000
  • symbol: SACOL0230
  • pan gene symbol?: —
  • synonym:
  • product: PTS system, sorbitol-specific IIB component

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0230 [new locus tag: SACOL_RS01170 ]
  • symbol: SACOL0230
  • product: PTS system, sorbitol-specific IIB component
  • replicon: chromosome
  • strand: +
  • coordinates: 269259..269537
  • length: 279
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAAT
    GCAATTGAAGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATT
    ACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAA
    AAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAA
    GAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA
    60
    120
    180
    240
    279

⊟Protein[edit | edit source]

Protein Data Bank: 5GQS

⊟General[edit | edit source]

  • locus tag: SACOL0230 [new locus tag: SACOL_RS01170 ]
  • symbol: SACOL0230
  • description: PTS system, sorbitol-specific IIB component
  • length: 92
  • theoretical pI: 5.86126
  • theoretical MW: 10178.8
  • GRAVY: -0.105435

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    Signal transduction Signal transduction PTS PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    and 2 more
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
    Signal transduction Signal transduction PTS PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
  • TheSEED  :
    • PTS system, D-arabitol/D-xylitol-specific IIB component, galactitol family
    Carbohydrates Monosaccharides D-Tagatose and Galactitol Utilization  PTS system, galactitol-specific IIB component (EC 2.7.1.69)
  • PFAM:
    Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 63.3)
    and 1 more
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 13.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.471099
    • TAT(Tat/SPI): 0.002537
    • LIPO(Sec/SPII): 0.021079
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL0230&oldid=82065"