From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01170 [old locus tag: SACOL0230 ]
  • pan locus tag?: SAUPAN001117000
  • symbol: SACOL_RS01170
  • pan gene symbol?:
  • synonym:
  • product: PTS galactitol transporter subunit IIB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01170 [old locus tag: SACOL0230 ]
  • symbol: SACOL_RS01170
  • product: PTS galactitol transporter subunit IIB
  • replicon: chromosome
  • strand: +
  • coordinates: 269259..269537
  • length: 279
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (269259..269537) NCBI
  • BioCyc: SACOL_RS01170 BioCyc
  • MicrobesOnline: see SACOL0230

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAAT
    GCAATTGAAGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATT
    ACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAA
    AAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAA
    GAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA
    60
    120
    180
    240
    279

Protein[edit | edit source]

Protein Data Bank: 5GQS

General[edit | edit source]

  • locus tag: SACOL_RS01170 [old locus tag: SACOL0230 ]
  • symbol: SACOL_RS01170
  • description: PTS galactitol transporter subunit IIB
  • length: 92
  • theoretical pI: 5.86126
  • theoretical MW: 10178.8
  • GRAVY: -0.105435

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    Signal transduction Signal transduction PTS PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    and 2 more
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
    Signal transduction Signal transduction PTS PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
  • TheSEED: see SACOL0230
  • PFAM:
    Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 53.4)
    and 4 more
    no clan defined DUF5737; Family of unknown function (DUF5737) (PF19008; HMM-score: 14.5)
    Iso_DH (CL0270) PTA_PTB; Phosphate acetyl/butaryl transferase (PF01515; HMM-score: 13.7)
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 13.4)
    no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9948
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0041
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.471099
    • TAT(Tat/SPI): 0.002537
    • LIPO(Sec/SPII): 0.021079
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: see SACOL0230
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]