Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS01280 [old locus tag: EGJ38_000256 ]
- pan locus tag?: SAUPAN001221000
- symbol: EGJ38_RS01280
- pan gene symbol?: —
- synonym:
- product: DUF4467 domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS01280 [old locus tag: EGJ38_000256 ]
- symbol: EGJ38_RS01280
- product: DUF4467 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 291176..291550
- length: 375
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (291176..291550) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAAGAATATTGGTAGTATTTTTAATGTTAGCAATTATATTGGCAGGTTGTTCTAAT
AAAGGTGAAAAGTATCAAAAAGATATTGATAAAGTGTACAAAGAACAGAATCAAATGAAT
AAAATTGCCTCGAAAGTACAAAACACTATTAAAACAGACATTAAACAAGAAGACAGTAAT
ACACATGTTTATAAAGATGGTAAAGTCATTGTTATTGGTATTCAATTATATAAAGATCGT
GAAAAAATGTATTATTTCGCATATGAAATAAAAGATGGTAAGGCAGAAATCAATAGAGAA
ATAGACCCAATTAAGTATATGAAAGACCATAAAGCAGATTATGAAGATGAAAATGTAGAA
GTGGAAAAAGATTAA60
120
180
240
300
360
375
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS01280 [old locus tag: EGJ38_000256 ]
- symbol: EGJ38_RS01280
- description: DUF4467 domain-containing protein
- length: 124
- theoretical pI: 7.49053
- theoretical MW: 14630.8
- GRAVY: -0.770161
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Surface structures pilus (Caulobacter type) biogenesis lipoprotein CpaD (TIGR02522; HMM-score: 13.3)Mobile and extrachromosomal element functions Plasmid functions entry exclusion lipoprotein TrbK (TIGR04359; HMM-score: 12.6)Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfgL (TIGR03300; HMM-score: 11.1)Unknown function General TIGR00374 family protein (TIGR00374; HMM-score: 10.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 125.5)and 8 moreOB (CL0021) tRNA_anti-like; tRNA_anti-like (PF12869; HMM-score: 17.5)Lysozyme (CL0037) SLT_4; Transglycosylase SLT domain (PF19489; HMM-score: 15.8)LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 15.3)no clan defined NusG_II; NusG domain II (PF07009; HMM-score: 14.5)SLATT (CL0676) SLATT_6; SMODS and SLOG-associating 2TM effector domain 6 (PF18169; HMM-score: 14.5)no clan defined DUF4995; Domain of unknown function (PF16386; HMM-score: 13.1)DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 12.9)DUF7537; Family of unknown function (DUF7537) (PF24381; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.7571
- Cell wall & surface Score: 0.0023
- Extracellular Score: 0.2406
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000302
- TAT(Tat/SPI): 0.00005
- LIPO(Sec/SPII): 0.999447
- Cleavage Site: CS pos: 17-18. LAG-CS. Pr: 1.0000
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000822161 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRILVVFLMLAIILAGCSNKGEKYQKDIDKVYKEQNQMNKIASKVQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPIKYMKDHKADYEDENVEVEKD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]