Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS01395 [old locus tag: EGJ38_000279 ]
- pan locus tag?: SAUPAN001856000
- symbol: EGJ38_RS01395
- pan gene symbol?: gcvH-L
- synonym:
- product: glycine cleavage system H family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS01395 [old locus tag: EGJ38_000279 ]
- symbol: EGJ38_RS01395
- product: glycine cleavage system H family protein
- replicon: chromosome
- strand: +
- coordinates: 316046..316378
- length: 333
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (316046..316378) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAGTTAGCCAATTATTTATGGGTAGAAAAAGTAGGAGATTTGTATGTGTTTAGT
ATGACACCTGAATTGCAAGATGATATTGGGACAGTAGGTTATGTTGAATTCGTAAGTCCA
GATGAAGTTAAAGTGGATGATGAAATTGTGAGTATCGAAGCATCGAAAACGGTCATTGAT
GTGCAAACGCCATTGTCAGGAACGATTATTGAGCGAAACACAAAAGCGGAAGAAGAACCG
ACAATTTTAAACTCTGAAAAACCAGAAGAAAATTGGTTGTTCAAATTGGATGATGTCGAT
AAAGAAGCATTCCTAGCATTACCGGAGGCTTAA60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS01395 [old locus tag: EGJ38_000279 ]
- symbol: EGJ38_RS01395
- description: glycine cleavage system H family protein
- length: 110
- theoretical pI: 3.86736
- theoretical MW: 12421.9
- GRAVY: -0.263636
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 57.2)and 3 moreglycine cleavage protein H-like protein (TIGR03077; HMM-score: 38.6)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 18.3)Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 9.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 61.1)and 2 moreBiotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 17.8)no clan defined DUF6763; Family of unknown function (DUF6763) (PF20549; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9941
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.0054
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010765
- TAT(Tat/SPI): 0.000132
- LIPO(Sec/SPII): 0.000825
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000731878 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVIDVQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]