From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS02970 [old locus tag: EGJ38_000595 ]
  • pan locus tag?: SAUPAN002500000
  • symbol: mnhF2
  • pan gene symbol?: mnhF2
  • synonym: mrpF2
  • product: Na+/H+ antiporter Mnh2 subunit F

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS02970 [old locus tag: EGJ38_000595 ]
  • symbol: mnhF2
  • product: Na+/H+ antiporter Mnh2 subunit F
  • replicon: chromosome
  • strand: +
  • coordinates: 629221..629523
  • length: 303
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (629221..629523) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATACAAACAATGACACATATTATGATTATTAGTTCACTCATTATTTTTGGAATTGCA
    TTAATCATCTGTTTATTTAGATTAATCAAGGGACCTACAACAGCAGATCGTGTCGTTACA
    TTTGATACAACAAGTGCTGTCGTAATGTCAATTGTGGGTGTGTTAAGTGTACTTATGGGC
    ACCGTTTCTTTCTTAGATTCAATCATGCTCATTGCCATTATATCTTTTGTAAGTTCTGTT
    TCAATATCACGCTTTATTGGTGGGGGGCATGTGTTTAATGGAAATAACAAAAGAAATCTT
    TAG
    60
    120
    180
    240
    300
    303


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS02970 [old locus tag: EGJ38_000595 ]
  • symbol: MnhF2
  • description: Na+/H+ antiporter Mnh2 subunit F
  • length: 100
  • theoretical pI: 10.7502
  • theoretical MW: 10747.9
  • GRAVY: 1.174

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance circular bacteriocin, circularin A/uberolysin family (TIGR03651; HMM-score: 5.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 48.2)
    and 2 more
    FumRed-TM (CL0335) Fumarate_red_C; Fumarate reductase subunit C (PF02300; HMM-score: 12.5)
    no clan defined DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 8.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.023346
    • TAT(Tat/SPI): 0.000367
    • LIPO(Sec/SPII): 0.014334
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000616795 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MIQTMTHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]