From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0615 [new locus tag: SAUSA300_RS03300 ]
  • pan locus tag?: SAUPAN002500000
  • symbol: SAUSA300_0615
  • pan gene symbol?: mnhF2
  • synonym: mrpF2
  • product: putative monovalent cation/H+ antiporter subunit F

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0615 [new locus tag: SAUSA300_RS03300 ]
  • symbol: SAUSA300_0615
  • product: putative monovalent cation/H+ antiporter subunit F
  • replicon: chromosome
  • strand: +
  • coordinates: 687255..687557
  • length: 303
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATACAAACAATAACACATATTATGATTATTAGTTCACTCATTATTTTTGGAATTGCA
    TTAATCATCTGTTTATTTAGATTAATCAAGGGACCTACAACAGCAGATCGTGTCGTTACA
    TTTGATACAACAAGTGCTGTCGTAATGTCAATTGTGGGTGTGTTAAGTGTACTTATGGGC
    ACCGTTTCTTTCTTAGATTCAATCATGCTCATTGCCATTATATCTTTTGTAAGTTCTGTT
    TCAATATCACGCTTTATTGGTGGGGGGCATGTGTTTAATGGAAATAACAAAAGAAATCTT
    TAG
    60
    120
    180
    240
    300
    303

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0615 [new locus tag: SAUSA300_RS03300 ]
  • symbol: SAUSA300_0615
  • description: putative monovalent cation/H+ antiporter subunit F
  • length: 100
  • theoretical pI: 10.7502
  • theoretical MW: 10729.9
  • GRAVY: 1.2

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance circular bacteriocin, circularin A/uberolysin family (TIGR03651; HMM-score: 5.2)
  • TheSEED  :
    • Na(+) H(+) antiporter subunit F (TC 2.A.63.1.3)
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit F (TC 2.A.63.1.3)
  • PFAM:
    no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 48.6)
    and 1 more
    DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 9.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.019091
    • TAT(Tat/SPI): 0.000307
    • LIPO(Sec/SPII): 0.012594
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Manisha Vaish, Alexa Price-Whelan, Tamara Reyes-Robles, Jun Liu, Amyeo Jereen, Stephanie Christie, Francis Alonzo, Meredith A Benson, Victor J Torres, Terry A Krulwich
    Roles of Staphylococcus aureus Mnh1 and Mnh2 Antiporters in Salt Tolerance, Alkali Tolerance, and Pathogenesis.
    J Bacteriol: 2018, 200(5);
    [PubMed:29263099] [WorldCat.org] [DOI] (I e)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_0615&oldid=104074"