Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0616 [new locus tag: SAUSA300_RS03305 ]
- pan locus tag?: SAUPAN002501000
- symbol: SAUSA300_0616
- pan gene symbol?: mnhG2
- synonym:
- product: putative monovalent cation/H+ antiporter subunit G
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0616 [new locus tag: SAUSA300_RS03305 ]
- symbol: SAUSA300_0616
- product: putative monovalent cation/H+ antiporter subunit G
- replicon: chromosome
- strand: +
- coordinates: 687532..687969
- length: 438
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915394 NCBI
- RefSeq: YP_493319 NCBI
- BioCyc: see SAUSA300_RS03305
- MicrobesOnline: 1292131 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGAAATAACAAAAGAAATCTTTAGTCTTATTGCTGCTGTGATGTTGTTGTTAGGTAGT
TTTATTGCTCTTATTAGTGCAATAGGTATCGTGAAATTCCAAGATGTTTTCTTAAGAAGT
CACGCTGCGACAAAAAGTTCAACTTTATCCGTGTTATTAACTTTAATCGGTGTATTAATT
TATTTTATTGTGAATACAGGATTTTTCAGTGTGCGTTTATTACTGTCACTTGTTTTTATT
AATTTAACTTCACCAGTCGGCATGCACTTAGTCGCTCGCGCTGCTTATCGCAACGGCGCT
TATATGTATCGAAAAAATGATGCTCACACACATGCATCAATATTATTAAGTTCAAATGAA
CAAAACTCTACAGAAGCATTACAATTACGTGCTGAAAAACGAGAAGAGCATCGTAAGAAA
TGGTATCAAAACGATTGA60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0616 [new locus tag: SAUSA300_RS03305 ]
- symbol: SAUSA300_0616
- description: putative monovalent cation/H+ antiporter subunit G
- length: 145
- theoretical pI: 10.1626
- theoretical MW: 16303
- GRAVY: 0.344828
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 90)and 1 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 15.9)
- TheSEED :
- Na(+) H(+) antiporter subunit G (TC 2.A.63.1.3)
- PFAM: no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 79)and 3 moreDUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 12.1)DUF7472; Family of unknown function (DUF7472) (PF24284; HMM-score: 8.3)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9996
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008271
- TAT(Tat/SPI): 0.0003
- LIPO(Sec/SPII): 0.021697
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNEQNSTEALQLRAEKREEHRKKWYQND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_0609 > SAUSA300_0610 > SAUSA300_0611 > SAUSA300_0612 > SAUSA300_0613 > SAUSA300_0614 > SAUSA300_0615 > SAUSA300_0616
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Manisha Vaish, Alexa Price-Whelan, Tamara Reyes-Robles, Jun Liu, Amyeo Jereen, Stephanie Christie, Francis Alonzo, Meredith A Benson, Victor J Torres, Terry A Krulwich
Roles of Staphylococcus aureus Mnh1 and Mnh2 Antiporters in Salt Tolerance, Alkali Tolerance, and Pathogenesis.
J Bacteriol: 2018, 200(5);
[PubMed:29263099] [WorldCat.org] [DOI] (I e)