Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0599 [new locus tag: NWMN_RS03415 ]
- pan locus tag?: SAUPAN002501000
- symbol: mnhG
- pan gene symbol?: mnhG2
- synonym:
- product: putative monovalent cation/H+ antiporter subunit G
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0599 [new locus tag: NWMN_RS03415 ]
- symbol: mnhG
- product: putative monovalent cation/H+ antiporter subunit G
- replicon: chromosome
- strand: +
- coordinates: 677883..678329
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332145 NCBI
- RefSeq: YP_001331633 NCBI
- BioCyc:
- MicrobesOnline: 3706146 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTGTTTAATGGAAATAACAAAAGAAATCTTTAGTCTTATTGCTGCTGTGATGTTGTTG
TTAGGTAGTTTTATTGCTCTTATTAGTGCAATAGGTATCGTGAAATTCCAAGATGTTTTC
TTAAGAAGTCACGCTGCGACAAAAAGTTCAACTTTATCCGTGTTATTAACTTTAATCGGT
GTATTAATTTATTTTATTGTGAATACAGGATTTTTCAGTGTGCGTTTATTACTGTCACTT
GTTTTTATTAATTTAACTTCACCAGTCGGCATGCACTTAGTCGCTCGCGCTGCTTATCGC
AACGGCGCTTATATGTATCGAAAAAATGATGCTCACACACATGCATCAATATTATTAAGT
TCAAATGAACAAAACTCTACAGAAGCATTACAATTACGTGCTGAAAAACGAGAAGAGCAT
CGTAAGAAATGGTATCAAAACGATTGA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0599 [new locus tag: NWMN_RS03415 ]
- symbol: MnhG
- description: putative monovalent cation/H+ antiporter subunit G
- length: 148
- theoretical pI: 9.97435
- theoretical MW: 16650.5
- GRAVY: 0.393243
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 89.9)and 1 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 15.6)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 78.4)and 4 moreCCB1; Cofactor assembly of complex C subunit B (PF12046; HMM-score: 15.8)DUF4029; Protein of unknown function (DUF4029) (PF13221; HMM-score: 9.1)DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 8.6)Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005345
- TAT(Tat/SPI): 0.000266
- LIPO(Sec/SPII): 0.01626
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MCLMEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNEQNSTEALQLRAEKREEHRKKWYQND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)