Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS03015 [old locus tag: EGJ38_000604 ]
- pan locus tag?: SAUPAN002513000
- symbol: tagH
- pan gene symbol?: tagH
- synonym: tarH
- product: teichoic acids export ABC transporter ATP-binding subunit TagH
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS03015 [old locus tag: EGJ38_000604 ]
- symbol: tagH
- product: teichoic acids export ABC transporter ATP-binding subunit TagH
- replicon: chromosome
- strand: -
- coordinates: 638502..639296
- length: 795
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (638502..639296) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGAACGTTTCGGTAAACATTAAAAATGTAACAAAAGAATATCGTATTTATCGTACAAAT
AAAGAACGTATGAAAGATGCGCTCATTCCCAAACATAAAAACAAAACATTTTTCGCTTTA
GATGACATTAGTTTAAAAGCATATGAAGGTGACGTCATAGGGCTTGTTGGCATCAATGGT
TCCGGCAAATCAACGTTGAGCAATATCATTGGCGGTTCTTTGTCGCCTACTGTTGGCAAA
GTGGATCGTAATGGTGAAGTCAGCGTTATCGCAATTAGTGCTGGCTTGAGTGGACAACTT
ACAGGGATTGAAAATATCGAATTTAAAATGTTATGTATGGGCTTTAAGCGAAAAGAAATT
AAAGCGATGACACCTAAGATTATTGAATTTAGTGAACTTGGTGAGTTTATTTATCAACCA
GTTAAAAAGTATTCAAGTGGTATGCGTGCAAAACTTGGTTTTTCAATTAATATCACAGTT
AATCCAGATATCTTAGTCATTGACGAAGCTTTATCTGTAGGTGACCAAACTTTTGCACAA
AAATGTTTAGATAAAATTTACGAGTTTAAAGAGCAAAACAAAACCATCTTTTTCGTTAGT
CATAACTTAGGACAAGTGAGACAATTTTGTACTAAGATTGCTTGGATTGAAGGCGGAAAG
TTAAAAGATTACGGTGAACTTGATGATGTATTACCTAAATATGAAGCTTTCCTTAACGAT
TTTAAAAAGAAATCCAAAGCCGAACAAAAAGAATTTAGAAACAAACTCGATGAGTCCCGC
TTCGTTATTAAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
795
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS03015 [old locus tag: EGJ38_000604 ]
- symbol: TagH
- description: teichoic acids export ABC transporter ATP-binding subunit TagH
- length: 264
- theoretical pI: 9.75396
- theoretical MW: 29762.3
- GRAVY: -0.294697
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 105.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 88)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 85.4)and 68 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 78)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 77.1)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 70.1)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 68)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 66)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 63.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 61.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 61.3)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 61.3)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 58)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 57.3)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 57)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 57)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 55.8)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 55.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 54.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 54.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 54.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 54.5)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 54.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 54.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 54)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 53.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.3)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 50.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 50.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 50.2)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 49.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 49.8)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 47.7)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 47.7)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 47.7)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 47.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 47.3)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 46.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 46.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 44.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 43.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 43.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 43.3)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 42.1)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 42)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 42)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 41.7)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 40.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 40.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 39.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 39)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 39)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 38.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 38.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 38.2)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 36.6)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 36.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 35.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 35.1)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 34.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 32.2)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 31.4)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 30.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 28.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 28.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 26.9)Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 16.5)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 64.2)and 9 moreMeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 18.3)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.9)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 12.9)AAA_22; AAA domain (PF13401; HMM-score: 12.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.7)AAA_18; AAA domain (PF13238; HMM-score: 11.5)NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.4)AAA_23; AAA domain (PF13476; HMM-score: 9.5)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 8.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1776
- Cytoplasmic Membrane Score: 0.6395
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1828
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.05335
- TAT(Tat/SPI): 0.000217
- LIPO(Sec/SPII): 0.000583
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001103232 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGINGSGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEIKAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQKCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLNDFKKKSKAEQKEFRNKLDESRFVIK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]