Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS03220 [old locus tag: EGJ38_000645 ]
- pan locus tag?: SAUPAN002561000
- symbol: EGJ38_RS03220
- pan gene symbol?: —
- synonym:
- product: SA0632 family lipoprotein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS03220 [old locus tag: EGJ38_000645 ]
- symbol: EGJ38_RS03220
- product: SA0632 family lipoprotein
- replicon: chromosome
- strand: +
- coordinates: 679995..680390
- length: 396
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (679995..680390) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAGAAATTAATCATTAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
AGCCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
TTAAAAGATAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAACAGAT
AAAGATCAAAAAGCTAATGACAAACACCAATCATAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS03220 [old locus tag: EGJ38_000645 ]
- symbol: EGJ38_RS03220
- description: SA0632 family lipoprotein
- length: 131
- theoretical pI: 9.36324
- theoretical MW: 15218
- GRAVY: -1.89771
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 19.9)Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 19.9)Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)and 13 moreSH3 domain protein (TIGR04211; HMM-score: 9.6)Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 8.1)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.6)type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.4)Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.1)Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 4.7)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.3)Cellular processes Cell division cell division protein FtsN (TIGR02223; HMM-score: 4.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 18.9)and 15 moreStriatin; Striatin family (PF08232; HMM-score: 12.8)Leu_zip; Leucine zipper (PF15294; HMM-score: 12.2)DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 10.5)Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 10.4)FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.2)BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 10.2)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 9.7)AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.3)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.3)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9)NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 8.5)YabA; Initiation control protein YabA (PF06156; HMM-score: 7.8)Snu56_snRNP; Snu56-like U1 small nuclear ribonucleoprotein component (PF19097; HMM-score: 7.2)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9452
- Cell wall & surface Score: 0.012
- Extracellular Score: 0.0428
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000361
- TAT(Tat/SPI): 0.000046
- LIPO(Sec/SPII): 0.999389
- Cleavage Site: CS pos: 17-18. LTG-CG. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000733432 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSTDKDQKANDKHQS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]