Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS04465 [old locus tag: EGJ38_000894 ]
- pan locus tag?: SAUPAN003030000
- symbol: EGJ38_RS04465
- pan gene symbol?: dltX
- synonym:
- product: teichoic acid D-Ala incorporation-associated protein DltX
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS04465 [old locus tag: EGJ38_000894 ]
- symbol: EGJ38_RS04465
- product: teichoic acid D-Ala incorporation-associated protein DltX
- replicon: chromosome
- strand: +
- coordinates: 892153..892305
- length: 153
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (892153..892305) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATCTAAAAGTAAACAGCCACCTAATAAATATGTTGAAGCATTCAAACCATATTTA
TTAACACTATTGTATTTGGCAATATTTATTACTTTATATTTAATTTATGGCAGTGGCGAC
ACACACAATAACTTCATTTATAATGAGTTCTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS04465 [old locus tag: EGJ38_000894 ]
- symbol: EGJ38_RS04465
- description: teichoic acid D-Ala incorporation-associated protein DltX
- length: 50
- theoretical pI: 9.38005
- theoretical MW: 5908.84
- GRAVY: -0.062
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: no clan defined DltX; D-Ala-teichoic acid biosynthesis protein (PF12459; HMM-score: 53.2)and 1 moreDUF3094; Protein of unknown function (DUF3094) (PF11293; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0011
- Cytoplasmic Membrane Score: 0.993
- Cell wall & surface Score: 0
- Extracellular Score: 0.0059
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.082304
- TAT(Tat/SPI): 0.001079
- LIPO(Sec/SPII): 0.03623
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000837752 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]