Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0934 [new locus tag: SACOL_RS04790 ]
- pan locus tag?: SAUPAN003030000
- symbol: SACOL0934
- pan gene symbol?: dltX
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0934 [new locus tag: SACOL_RS04790 ]
- symbol: SACOL0934
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 937718..937870
- length: 153
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237726 NCBI
- RefSeq: YP_185804 NCBI
- BioCyc:
- MicrobesOnline: 912404 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATCTAAAAGTAAACAGCCACCTAATAAATATGTTGAAGCATTCAAACCATATTTA
TTAACACTATTGTATTTGGCAATATTTATTACTTTATATTTAATTTATGGCAGTGGCGAC
ACACACAATAACTTCATTTATAATGAGTTCTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0934 [new locus tag: SACOL_RS04790 ]
- symbol: SACOL0934
- description: hypothetical protein
- length: 50
- theoretical pI: 9.38005
- theoretical MW: 5908.84
- GRAVY: -0.062
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108580: hypothetical protein
- PFAM: no clan defined DUF3687; D-Ala-teichoic acid biosynthesis protein (PF12459; HMM-score: 57.8)and 1 moreDUF3094; Protein of unknown function (DUF3094) (PF11293; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.082304
- TAT(Tat/SPI): 0.001079
- LIPO(Sec/SPII): 0.03623
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]