From AureoWiki
(Redirected from JSNZ 000894)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000894 [new locus tag: EGJ38_RS04465 ]
  • pan locus tag?: SAUPAN003030000
  • symbol: dltX
  • pan gene symbol?: dltX
  • synonym:
  • alternate name: JSNZ_000894
  • product: teichoic acid D-Ala incorporation-associated protein DltX

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000894 [new locus tag: EGJ38_RS04465 ]
  • symbol: dltX
  • product: teichoic acid D-Ala incorporation-associated protein DltX
  • replicon: chromosome
  • strand: +
  • coordinates: 892153..892305
  • length: 153
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422866 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAAATCTAAAAGTAAACAGCCACCTAATAAATATGTTGAAGCATTCAAACCATATTTA
    TTAACACTATTGTATTTGGCAATATTTATTACTTTATATTTAATTTATGGCAGTGGCGAC
    ACACACAATAACTTCATTTATAATGAGTTCTAA
    60
    120
    153

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000894 [new locus tag: EGJ38_RS04465 ]
  • symbol: DltX
  • description: teichoic acid D-Ala incorporation-associated protein DltX
  • length: 50
  • theoretical pI: 9.38005
  • theoretical MW: 5908.84
  • GRAVY: -0.062

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman
  • PFAM:
    no clan defined DltX; D-Ala-teichoic acid biosynthesis protein (PF12459; HMM-score: 53.2)
    and 1 more
    DUF3094; Protein of unknown function (DUF3094) (PF11293; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0011
    • Cytoplasmic Membrane Score: 0.993
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0059
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.082304
    • TAT(Tat/SPI): 0.001079
    • LIPO(Sec/SPII): 0.03623
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422866 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]