Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
- pan locus tag?: SAUPAN003039000
- symbol: EGJ38_RS04510
- pan gene symbol?: sufA
- synonym:
- product: HesB/IscA family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
- symbol: EGJ38_RS04510
- product: HesB/IscA family protein
- replicon: chromosome
- strand: +
- coordinates: 899033..899392
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (899033..899392) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCCAACAGTTATATTAACAGAAGCAGCTGCCTACGAAGTAAAAGATATGCTTAAAGCA
AATGAAATGCCAGATGGCTATTTAAAAATTAAAGTGAATGGTGGCGGGTGCACTGGTTTA
ACATACGGTATGGGTGCAGAAGAAGCGCCTGGTGAAAATGATGAAGTCTTAGAATACTTT
GGATTAAAAGTATTAGTAGACAAAGAAGATGCACCCGTATTAAATGGTACGACTATTGAT
TTTAAGCAATCATTAATGGGTGGCGGTTTCCAAATCGACAATCCTAATGCAATTGCTTCA
TGTGGCTGTGGTAGTTCATTTAGAACTGCAAAAGTTGCAGGTAATCCTGAAAATTGCTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
- symbol: EGJ38_RS04510
- description: HesB/IscA family protein
- length: 119
- theoretical pI: 4.09478
- theoretical MW: 12486.1
- GRAVY: -0.157143
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly accessory protein (TIGR00049; HMM-score: 111.7)and 4 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly scaffold SufA (TIGR01997; HMM-score: 82.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly protein IscA (TIGR02011; HMM-score: 66.5)Unknown function General HesB-like selenoprotein (TIGR01911; HMM-score: 41.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 28.8)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined Fe-S_biosyn; Iron-sulphur cluster biosynthesis (PF01521; HMM-score: 62.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9382
- Cytoplasmic Membrane Score: 0.0094
- Cell wall & surface Score: 0
- Extracellular Score: 0.0523
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.116282
- TAT(Tat/SPI): 0.000656
- LIPO(Sec/SPII): 0.002691
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001143495 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLKVLVDKEDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]