From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
  • pan locus tag?: SAUPAN003039000
  • symbol: EGJ38_RS04510
  • pan gene symbol?: sufA
  • synonym:
  • product: HesB/IscA family protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
  • symbol: EGJ38_RS04510
  • product: HesB/IscA family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 899033..899392
  • length: 360
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (899033..899392) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCCAACAGTTATATTAACAGAAGCAGCTGCCTACGAAGTAAAAGATATGCTTAAAGCA
    AATGAAATGCCAGATGGCTATTTAAAAATTAAAGTGAATGGTGGCGGGTGCACTGGTTTA
    ACATACGGTATGGGTGCAGAAGAAGCGCCTGGTGAAAATGATGAAGTCTTAGAATACTTT
    GGATTAAAAGTATTAGTAGACAAAGAAGATGCACCCGTATTAAATGGTACGACTATTGAT
    TTTAAGCAATCATTAATGGGTGGCGGTTTCCAAATCGACAATCCTAATGCAATTGCTTCA
    TGTGGCTGTGGTAGTTCATTTAGAACTGCAAAAGTTGCAGGTAATCCTGAAAATTGCTAA
    60
    120
    180
    240
    300
    360


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS04510 [old locus tag: EGJ38_000903 ]
  • symbol: EGJ38_RS04510
  • description: HesB/IscA family protein
  • length: 119
  • theoretical pI: 4.09478
  • theoretical MW: 12486.1
  • GRAVY: -0.157143

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly accessory protein (TIGR00049; HMM-score: 111.7)
    and 4 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly scaffold SufA (TIGR01997; HMM-score: 82.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly protein IscA (TIGR02011; HMM-score: 66.5)
    Unknown function General HesB-like selenoprotein (TIGR01911; HMM-score: 41.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 28.8)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Fe-S_biosyn; Iron-sulphur cluster biosynthesis (PF01521; HMM-score: 62.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9382
    • Cytoplasmic Membrane Score: 0.0094
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0523
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.116282
    • TAT(Tat/SPI): 0.000656
    • LIPO(Sec/SPII): 0.002691
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001143495 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLKVLVDKEDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]