Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS04960 [old locus tag: EGJ38_000993 ]
- pan locus tag?: SAUPAN003220000
- symbol: EGJ38_RS04960
- pan gene symbol?: —
- synonym:
- product: lactococcin 972 family bacteriocin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS04960 [old locus tag: EGJ38_000993 ]
- symbol: EGJ38_RS04960
- product: lactococcin 972 family bacteriocin
- replicon: chromosome
- strand: +
- coordinates: 998751..999023
- length: 273
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (998751..999023) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATTTTTGGCACTATATTATATTTAACTTTAGCACTTGGATTATCAACAGCAGCTTATGCA
TCTACAGAATACGCAGAAGGAGGCACTTGGAGTCACGGTGTCGGCAGTAAGTATGTTTGG
TCTTATTATTATCATGGTCATAAAGGACATGGTGCAACAGCTATTGGAAAATACAGATCA
TTTAGTGGTTATACAAGAGCTGGTGTAAAAGCAAAAGCATCAGCTACTAAAAATAATTGG
TGGGTCAATAGAGCATATTATAACATTTATTAA60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS04960 [old locus tag: EGJ38_000993 ]
- symbol: EGJ38_RS04960
- description: lactococcin 972 family bacteriocin
- length: 90
- theoretical pI: 9.98788
- theoretical MW: 9992.1
- GRAVY: -0.314444
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 37.2)
- TheSEED:
- PFAM: no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 49.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.9999
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 20 aa
- SP(Sec/SPI): 0.978106
- TAT(Tat/SPI): 0.00649
- LIPO(Sec/SPII): 0.011467
- Cleavage Site: CS pos: 20-21. AYA-ST. Pr: 0.7652
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_072398135 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGTILYLTLALGLSTAAYASTEYAEGGTWSHGVGSKYVWSYYYHGHKGHGATAIGKYRSFSGYTRAGVKAKASATKNNWWVNRAYYNIY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]