Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS05495 [old locus tag: EGJ38_001100 ]
- pan locus tag?: SAUPAN003368000
- symbol: isdG
- pan gene symbol?: isdG
- synonym:
- product: staphylobilin-forming heme oxygenase IsdG
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS05495 [old locus tag: EGJ38_001100 ]
- symbol: isdG
- product: staphylobilin-forming heme oxygenase IsdG
- replicon: chromosome
- strand: +
- coordinates: 1104140..1104463
- length: 324
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1104140..1104463) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTTATGGCAGAAAATAGGCTGACGTTAACAAAAGGAACAGCAAAAGATATTATA
GAACGATTTTACACGAGACATGGGATTGAAACATTAGAAGGCTTTGATGGCATGTTTGTT
ACACAAACTTTAGAACAAGAAGATTTTGATGAAGTGAAAATTTTAACAGTTTGGAAATCA
AAGCAAGCTTTTACGGATTGGTTAAAATCTGATGTCTTTAAAGCAGCGCATAAACATGTT
AGAAGTAAAAATGAAGATGAAAGTAGCCCGATTATAAATAACAAAGTAATTACATATGAT
ATAGGCTATAGTTACATGAAATAA60
120
180
240
300
324
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS05495 [old locus tag: EGJ38_001100 ]
- symbol: IsdG
- description: staphylobilin-forming heme oxygenase IsdG
- length: 107
- theoretical pI: 6.80692
- theoretical MW: 12546.2
- GRAVY: -0.566355
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Aspartate family homoserine O-succinyltransferase (TIGR01001; EC 2.3.1.46; HMM-score: 15.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 52.9)and 3 moreGlutaminase_I (CL0014) HTS; Homoserine O-succinyltransferase (PF04204; HMM-score: 15.4)HTH (CL0123) KilA-N; KilA-N domain (PF04383; HMM-score: 13.5)Dim_A_B_barrel (CL0032) Dehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9587
- Cytoplasmic Membrane Score: 0.024
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0171
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002024
- TAT(Tat/SPI): 0.000226
- LIPO(Sec/SPII): 0.000347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000670950 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur, LacR see EGJ38_001100
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]