Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
- pan locus tag?: SAUPAN003437000
- symbol: EGJ38_RS05695
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
- symbol: EGJ38_RS05695
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1141417..1141605
- length: 189
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1141417..1141605) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGAAATCAAATTCAAAAACTATTAGACAGTGATTTGAGCAGTTTACATATATCGAAA
CAAACAGGAGTTCCACAAAGCACAATACACAGAATGAGAAAAAATGAAAGATCATTAGAC
AATATGTCATTGAAAAACGCTGAACTACTTTATAAATTTGCCAATAGTATATTTAGCAAT
GAAAATTAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
- symbol: EGJ38_RS05695
- description: hypothetical protein
- length: 62
- theoretical pI: 10.3639
- theoretical MW: 7192.13
- GRAVY: -0.770968
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 15.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 16.3)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 16)Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 14)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.3)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 13.3)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.1)and 1 moreHTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9713
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0284
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009088
- TAT(Tat/SPI): 0.001115
- LIPO(Sec/SPII): 0.001306
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001245802 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKNERSLDNMSLKNAELLYKFANSIFSNEN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]