From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
  • pan locus tag?: SAUPAN003437000
  • symbol: EGJ38_RS05695
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
  • symbol: EGJ38_RS05695
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1141417..1141605
  • length: 189
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1141417..1141605) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAGAAATCAAATTCAAAAACTATTAGACAGTGATTTGAGCAGTTTACATATATCGAAA
    CAAACAGGAGTTCCACAAAGCACAATACACAGAATGAGAAAAAATGAAAGATCATTAGAC
    AATATGTCATTGAAAAACGCTGAACTACTTTATAAATTTGCCAATAGTATATTTAGCAAT
    GAAAATTAA
    60
    120
    180
    189

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS05695 [old locus tag: EGJ38_001140 ]
  • symbol: EGJ38_RS05695
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3639
  • theoretical MW: 7192.13
  • GRAVY: -0.770968

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 15.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman
  • PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 16.3)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 16)
    Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 14)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.3)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 13.3)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.1)
    and 1 more
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9713
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0284
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009088
    • TAT(Tat/SPI): 0.001115
    • LIPO(Sec/SPII): 0.001306
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001245802 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKNERSLDNMSLKNAELLYKFANSIFSNEN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]