From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS08165 [old locus tag: EGJ38_001635 ]
  • pan locus tag?: SAUPAN004251000
  • symbol: rpmA
  • pan gene symbol?: rpmA
  • synonym:
  • product: 50S ribosomal protein L27

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS08165 [old locus tag: EGJ38_001635 ]
  • symbol: rpmA
  • product: 50S ribosomal protein L27
  • replicon: chromosome
  • strand: -
  • coordinates: 1672867..1673151
  • length: 285
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1672867..1673151) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTAAAATTAAACTTACAATTCTTCGCATCTAAAAAAGGGGTAAGTTCTACAAAAAAC
    GGACGTGACTCTGAATCAAAACGCTTAGGTGCTAAACGTGCTGACGGTCAATTCGTAACA
    GGTGGTTCAATTTTATATCGCCAACGTGGTACTAAAATTTACCCTGGTGAAAATGTAGGT
    CGTGGTGGCGATGATACATTATTCGCTAAAATCGACGGCGTTGTTAAATTCGAACGTAAA
    GGTCGCGACAAAAAACAAGTTTCTGTATATGCAGTAGCTGAATAA
    60
    120
    180
    240
    285


Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: EGJ38_RS08165 [old locus tag: EGJ38_001635 ]
  • symbol: RpmA
  • description: 50S ribosomal protein L27
  • length: 94
  • theoretical pI: 10.8424
  • theoretical MW: 10314.7
  • GRAVY: -0.689362

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL27 (TIGR00062; HMM-score: 132.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Ribosomal_L27; Ribosomal L27 protein (PF01016; HMM-score: 119.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7651
    • Cytoplasmic Membrane Score: 0.0033
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.2314
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021947
    • TAT(Tat/SPI): 0.003805
    • LIPO(Sec/SPII): 0.0037
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000916187 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]