Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
- pan locus tag?: SAUPAN005693000
- symbol: rpsQ
- pan gene symbol?: rpsQ
- synonym:
- product: 30S ribosomal protein S17
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
- symbol: rpsQ
- product: 30S ribosomal protein S17
- replicon: chromosome
- strand: -
- coordinates: 2210945..2211208
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2210945..2211208) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAGCGAAAGAAACGATCGTAAAGTTTATGTAGGTAAAGTTGTTTCAGACAAAATGGAC
AAGACTATTACAGTACTTGTTGAAACTTACAAAACACACAAATTATACGGTAAACGAGTA
AAATACTCTAAAAAATACAAAACTCATGATGAAAACAATTCAGCTAAATTAGGAGACATT
GTTAAAATTCAAGAAACTCGTCCTTTATCAGCAACAAAACGTTTTCGTTTAGTAGAGATT
GTTGAAGAGTCAGTAATTATTTAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS11005 [old locus tag: EGJ38_002205 ]
- symbol: RpsQ
- description: 30S ribosomal protein S17
- length: 87
- theoretical pI: 10.362
- theoretical MW: 10174.8
- GRAVY: -0.696552
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03635; HMM-score: 115.3)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03630; HMM-score: 40.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: OB (CL0021) Ribosomal_S17; Ribosomal protein S17 (PF00366; HMM-score: 109.9)and 1 morePCB_OB; Penicillin-binding protein OB-like domain (PF17092; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4865
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.5134
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007954
- TAT(Tat/SPI): 0.000534
- LIPO(Sec/SPII): 0.001166
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000004086 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]