Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS12000 [old locus tag: EGJ38_002404 ]
- pan locus tag?: SAUPAN005976000
- symbol: EGJ38_RS12000
- pan gene symbol?: —
- synonym:
- product: type I toxin-antitoxin system Fst family toxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS12000 [old locus tag: EGJ38_002404 ]
- symbol: EGJ38_RS12000
- product: type I toxin-antitoxin system Fst family toxin
- replicon: chromosome
- strand: -
- coordinates: 2402488..2402595
- length: 108
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2402488..2402595) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTT
TTTGCACATTGGTTACGAACGCGCAACAATAAAAAAGGTGACAAATAA60
108
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS12000 [old locus tag: EGJ38_002404 ]
- symbol: EGJ38_RS12000
- description: type I toxin-antitoxin system Fst family toxin
- length: 35
- theoretical pI: 10.5006
- theoretical MW: 4012.75
- GRAVY: 0.177143
⊟Function[edit | edit source]
- TIGRFAM: IPTL-CTERM protein sorting domain (TIGR04174; HMM-score: 12.7)
- TheSEED:
- PFAM: Holin-III (CL0564) Phage_holin_3_3; LydA holin phage, holin superfamily III (PF16083; HMM-score: 14.4)no clan defined Herpes_HEPA; Herpesvirus DNA helicase/primase complex associated protein (PF03324; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0012
- Cytoplasmic Membrane Score: 0.9065
- Cell wall & surface Score: 0
- Extracellular Score: 0.0923
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 15 aa
- SP(Sec/SPI): 0.037157
- TAT(Tat/SPI): 0.003544
- LIPO(Sec/SPII): 0.642424
- Cleavage Site: CS pos: 15-16. LSG-CL. Pr: 0.6201
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000482647 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]