Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2433 [new locus tag: SACOL_RS12770 ]
- pan locus tag?: SAUPAN005976000
- symbol: SACOL2433
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2433 [new locus tag: SACOL_RS12770 ]
- symbol: SACOL2433
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2491945..2492052
- length: 108
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238692 NCBI
- RefSeq: YP_187234 NCBI
- BioCyc: see SACOL_RS12770
- MicrobesOnline: 913911 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTT
TTTGCACATTGGTTACGAACGCGCAACAATAAAAAAGGTGACAAATAA60
108
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2433 [new locus tag: SACOL_RS12770 ]
- symbol: SACOL2433
- description: hypothetical protein
- length: 35
- theoretical pI: 11.06
- theoretical MW: 4011.76
- GRAVY: 0.197143
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: Holin-III (CL0564) Phage_holin_3_3; LydA holin phage, holin superfamily III (PF16083; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide LIPO(Sec/SPII) length 15 aa
- SP(Sec/SPI): 0.039777
- TAT(Tat/SPI): 0.002981
- LIPO(Sec/SPII): 0.710081
- Cleavage Site: CS pos: 15-16. ISG-CL. Pr: 0.6895
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.