From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS12285 [old locus tag: EGJ38_002462 ]
  • pan locus tag?: SAUPAN006070000
  • symbol: EGJ38_RS12285
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS12285 [old locus tag: EGJ38_002462 ]
  • symbol: EGJ38_RS12285
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2458544..2458870
  • length: 327
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2458544..2458870) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
    CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
    GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
    ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
    CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
    TCTGACAGAATTGAAGGAGATGAATAA
    60
    120
    180
    240
    300
    327


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS12285 [old locus tag: EGJ38_002462 ]
  • symbol: EGJ38_RS12285
  • description: hypothetical protein
  • length: 108
  • theoretical pI: 5.63959
  • theoretical MW: 13586.1
  • GRAVY: -1.45

Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 9.7)
    and 3 more
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)
    Genetic information processing Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 6.9)
    variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    TPR (CL0020) CHIP_TPR_N; CHIP N-terminal tetratricopeptide repeat domain (PF18391; HMM-score: 15.7)
    HTH (CL0123) wHTH_TTC3; TTC3-like, winged helix turn helix domain (PF24812; HMM-score: 15)
    no clan defined SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 13.9)
    Biopterin_H; Biopterin-dependent aromatic amino acid hydroxylase (PF00351; HMM-score: 13.6)
    AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.3)
    DUF3106; Protein of unknown function (DUF3106) (PF11304; HMM-score: 12.9)
    and 10 more
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.2)
    ZapG-like; Z-ring associated protein G-like (PF06295; HMM-score: 10.8)
    DUF5798; Family of unknown function (DUF5798) (PF19111; HMM-score: 10.7)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.6)
    Amidase; Amidase (PF01425; HMM-score: 10.2)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 9.9)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9.4)
    PhoU (CL0297) PhoU; PhoU domain (PF01895; HMM-score: 8.6)
    no clan defined CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8.2)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 6.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.511
    • Cytoplasmic Membrane Score: 0.1321
    • Cell wall & surface Score: 0.0077
    • Extracellular Score: 0.3492
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004856
    • TAT(Tat/SPI): 0.000517
    • LIPO(Sec/SPII): 0.001212
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000495498 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]