From AureoWiki
(Redirected from JSNZ 000502)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
  • pan locus tag?: SAUPAN002316000
  • symbol: rplGB
  • pan gene symbol?: rplGB
  • synonym:
  • alternate name: JSNZ_000502
  • product: ribosomal L7Ae/L30e/S12e/Gadd45 family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
  • symbol: rplGB
  • product: ribosomal L7Ae/L30e/S12e/Gadd45 family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 535091..535345
  • length: 255
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422482 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAA
    ACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAA
    GTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTT
    TTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTA
    GCATTGATTAAATGA
    60
    120
    180
    240
    255

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
  • symbol: RplGB
  • description: ribosomal L7Ae/L30e/S12e/Gadd45 family protein
  • length: 84
  • theoretical pI: 10.8182
  • theoretical MW: 9446.19
  • GRAVY: 0.0607143

Function[edit | edit source]

  • TIGRFAM:
    ribosomal protein eL8 (TIGR03677; HMM-score: 37.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 39.2)
    and 4 more
    eRF1_3; eRF1 domain 3 (PF03465; HMM-score: 17.4)
    no clan defined DUF1694; Protein of unknown function (DUF1694) (PF07997; HMM-score: 14.8)
    HAD_Pex22; Peroxisome biogenesis protein 22, Haloacid dehydrogenase-like domain (PF22978; HMM-score: 14.3)
    Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 14.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9925
    • Cytoplasmic Membrane Score: 0.0019
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0056
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001767
    • TAT(Tat/SPI): 0.000214
    • LIPO(Sec/SPII): 0.00029
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422482 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]