From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000799
  • pan locus tag?: SAUPAN002892000
  • symbol: JSNZ_000799
  • pan gene symbol?:
  • synonym:
  • product: CsbD family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000799
  • symbol: JSNZ_000799
  • product: CsbD family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 829479..829673
  • length: 195
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAAT
    GTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCG
    AAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGT
    AACAAAGGCGAGTAA
    60
    120
    180
    195

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000799
  • symbol: JSNZ_000799
  • description: CsbD family protein
  • length: 64
  • theoretical pI: 4.86657
  • theoretical MW: 7018.64
  • GRAVY: -1.35781

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 58.8)
    and 3 more
    no clan defined MT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 16.3)
    YtxH; YtxH-like protein (PF12732; HMM-score: 15.2)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 14.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5397
    • Cytoplasmic Membrane Score: 0.0027
    • Cell wall & surface Score: 0.1426
    • Extracellular Score: 0.315
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.015799
    • TAT(Tat/SPI): 0.00346
    • LIPO(Sec/SPII): 0.005712
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1] [2] [3]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  3. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]