(Redirected from JSNZ 000989)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000989 [new locus tag: EGJ38_RS04940 ]
- pan locus tag?: SAUPAN003214000
- symbol: EGJ38_000989
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000989
- product: YkvS family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000989 [new locus tag: EGJ38_RS04940 ]
- symbol: EGJ38_000989
- product: YkvS family protein
- replicon: chromosome
- strand: +
- coordinates: 996928..997104
- length: 177
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422958 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000989 [new locus tag: EGJ38_RS04940 ]
- symbol: EGJ38_000989
- description: YkvS family protein
- length: 58
- theoretical pI: 4.46294
- theoretical MW: 6676.64
- GRAVY: -0.17069
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: SH3 (CL0010) DUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 96.1)and 4 moreKOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 18.1)NTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 15.5)no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 13.1)Miga; Mitoguardin (PF10265; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9932
- Cytoplasmic Membrane Score: 0.002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0048
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005589
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.001709
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422958 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000989 > EGJ38_000990
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)