Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS027 [new locus tag: SA_RS05010 ]
- pan locus tag?: SAUPAN003214000
- symbol: SAS027
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS027 [new locus tag: SA_RS05010 ]
- symbol: SAS027
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1005201..1005377
- length: 177
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123705 NCBI
- RefSeq: NP_374149 NCBI
- BioCyc: see SA_RS05010
- MicrobesOnline: 103175 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS027 [new locus tag: SA_RS05010 ]
- symbol: SAS027
- description: hypothetical protein
- length: 58
- theoretical pI: 4.46294
- theoretical MW: 6676.64
- GRAVY: -0.17069
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
- TheSEED :
- FIG01108367: hypothetical protein
- PFAM: SH3 (CL0010) DUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 96.1)and 4 moreKOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 18.1)NTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 15.5)no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 13.1)Miga; Mitoguardin (PF10265; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9932
- Cytoplasmic Membrane Score: 0.002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0048
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005589
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.001709
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)