From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2031 [new locus tag: SA_RS11680 ]
  • pan locus tag?: SAUPAN005685000
  • symbol: rpsE
  • pan gene symbol?: rpsE
  • synonym:
  • product: 30S ribosomal protein S5

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2031 [new locus tag: SA_RS11680 ]
  • symbol: rpsE
  • product: 30S ribosomal protein S5
  • replicon: chromosome
  • strand: -
  • coordinates: 2300096..2300596
  • length: 501
  • essential: yes [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCTCGTAGAGAAGAAGAGACGAAAGAATTTGAAGAACGCGTTGTTACAATCAACCGT
    GTAGCAAAAGTTGTAAAAGGTGGTCGTCGTTTCCGTTTCACTGCATTAGTTGTAGTTGGA
    GACAAAAATGGTCGTGTAGGTTTCGGTACTGGTAAAGCTCAAGAGGTACCAGAAGCAATC
    AAAAAAGCTGTTGAAGCAGCTAAAAAAGATTTAGTAGTTGTTCCACGTGTTGAAGGTACA
    ACTCCACACACAATTACTGGCCGTTACGGTTCAGGAAGCGTATTTATGAAACCGGCTGCA
    CCTGGTACAGGAGTTATCGCTGGTGGTCCTGTTCGTGCCGTACTTGAATTAGCAGGTATC
    ACTGATATCTTAAGTAAATCATTAGGATCAAACACACCAATCAACATGGTTCGTGCTACA
    ATCGATGGTTTACAAAACCTTAAAAATGCTGAAGATGTTGCGAAATTACGTGGCAAAACA
    GTAGAAGAATTATACAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501


Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SA2031 [new locus tag: SA_RS11680 ]
  • symbol: RpsE
  • description: 30S ribosomal protein S5
  • length: 166
  • theoretical pI: 10.5901
  • theoretical MW: 17742.4
  • GRAVY: -0.204217

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01021; HMM-score: 233.5)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01020; HMM-score: 108.1)
  • TheSEED  :
    • SSU ribosomal protein S5p (S2e)
    Protein Metabolism Protein biosynthesis Ribosome SSU bacterial  SSU ribosomal protein S5p (S2e)
    and 1 more
    Protein Metabolism Protein processing and modification Ribosomal protein S5p acylation  SSU ribosomal protein S5p (S2e)
  • PFAM:
    S5 (CL0329) Ribosomal_S5_C; Ribosomal protein S5, C-terminal domain (PF03719; HMM-score: 112.4)
    DSRM (CL0196) Ribosomal_S5; Ribosomal protein S5, N-terminal domain (PF00333; HMM-score: 103.2)
    and 1 more
    Maf (CL0269) NTPase_I-T; Protein of unknown function DUF84 (PF01931; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9272
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0716
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010797
    • TAT(Tat/SPI): 0.009728
    • LIPO(Sec/SPII): 0.00158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]