Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2031 [new locus tag: SA_RS11680 ]
- pan locus tag?: SAUPAN005685000
- symbol: rpsE
- pan gene symbol?: rpsE
- synonym:
- product: 30S ribosomal protein S5
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2031 [new locus tag: SA_RS11680 ]
- symbol: rpsE
- product: 30S ribosomal protein S5
- replicon: chromosome
- strand: -
- coordinates: 2300096..2300596
- length: 501
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124951 NCBI
- RefSeq: NP_375346 NCBI
- BioCyc: see SA_RS11680
- MicrobesOnline: 104372 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGCTCGTAGAGAAGAAGAGACGAAAGAATTTGAAGAACGCGTTGTTACAATCAACCGT
GTAGCAAAAGTTGTAAAAGGTGGTCGTCGTTTCCGTTTCACTGCATTAGTTGTAGTTGGA
GACAAAAATGGTCGTGTAGGTTTCGGTACTGGTAAAGCTCAAGAGGTACCAGAAGCAATC
AAAAAAGCTGTTGAAGCAGCTAAAAAAGATTTAGTAGTTGTTCCACGTGTTGAAGGTACA
ACTCCACACACAATTACTGGCCGTTACGGTTCAGGAAGCGTATTTATGAAACCGGCTGCA
CCTGGTACAGGAGTTATCGCTGGTGGTCCTGTTCGTGCCGTACTTGAATTAGCAGGTATC
ACTGATATCTTAAGTAAATCATTAGGATCAAACACACCAATCAACATGGTTCGTGCTACA
ATCGATGGTTTACAAAACCTTAAAAATGCTGAAGATGTTGCGAAATTACGTGGCAAAACA
GTAGAAGAATTATACAATTAA60
120
180
240
300
360
420
480
501
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2031 [new locus tag: SA_RS11680 ]
- symbol: RpsE
- description: 30S ribosomal protein S5
- length: 166
- theoretical pI: 10.5901
- theoretical MW: 17742.4
- GRAVY: -0.204217
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01021; HMM-score: 233.5)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01020; HMM-score: 108.1)
- TheSEED :
- SSU ribosomal protein S5p (S2e)
and 1 more - PFAM: S5 (CL0329) Ribosomal_S5_C; Ribosomal protein S5, C-terminal domain (PF03719; HMM-score: 112.4)DSRM (CL0196) Ribosomal_S5; Ribosomal protein S5, N-terminal domain (PF00333; HMM-score: 103.2)and 1 moreMaf (CL0269) NTPase_I-T; Protein of unknown function DUF84 (PF01931; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9272
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0716
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010797
- TAT(Tat/SPI): 0.009728
- LIPO(Sec/SPII): 0.00158
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p)